C1QL2 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• C1QL2 Recombinant monoclonal antibody (87797-1-RR)

• 

  WB analysis using 87797-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87797-1-RR (C1QL2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 87797-1-RR

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using C1QL2 antibody (87797-1-RR, Clone: 253329D5 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

C1QL2 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 87797-1-RR

Clone No.253329D5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, IF/ICC, ELISA

Synonyms

C1q and tumor necrosis factor-related protein 10, C1q/TNF-related protein 10, Complement C1q-like protein 2, CTRP10

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, mouse brain tissue, rat brain tissue, pig brain tissue
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87797-1-RR targets C1QL2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag37614

  Product name: Recombinant human C1QL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 22-80 aa of NM_182528

  Sequence: HYEMMGTCRMICDPYTAAPGGEPPGAKAQPPGPSTAALEVMQDLSANPPPPFIQGPKGD

• Full Name: complement component 1, q subcomponent-like 2
• Calculated Molecular Weight: 29 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: NM_182528
• Gene Symbol: C1QL2
• Gene ID (NCBI): 165257
• RRID: AB_3745755
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q7Z5L3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Complement C1q-like protein 2 (C1QL2, also known as CTRP10) is a member of the C1q-like protein family. It is a secreted protein that plays a role in synaptic organization and function. C1QL2 is involved in the formation and maintenance of synapses, particularly in the central nervous system (CNS) (PMID: 20646056). It interacts with specific neurexin-3 isoforms to recruit synaptic vesicles and modulate synaptic transmission. Additionally, C1QL2 has been implicated in the regulation of hippocampal mossy fiber-CA3 synapse function, suggesting its role in synaptic plasticity and memory formation (PMID: 28219683).