C1QL3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• C1QL3 Polyclonal antibody (32175-1-AP)

• 

  WB analysis using 32175-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32175-1-AP (C1QL3 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

C1QL3 Polyclonal Antibody for WB, ELISA

Cat No. 32175-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

C1q and tumor necrosis factor-related protein 13, C1q/TNF-related protein 13, Complement C1q-like protein 3, CTRP13

---

Tested Applications

• Positive WB detected in: SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32175-1-AP targets C1QL3 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37280

  Product name: Recombinant human C1QL3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 91-140 aa of BC127716

  Sequence: GEKGEPGRQGLPGPPGAPGLNAAGAISAATYSTVPKIAFYAGLKRQHEGY

• Full Name: complement component 1, q subcomponent-like 3
• Calculated Molecular Weight: 27 kDa
• Observed Molecular Weight: 70 kDa, 27 kDa
• GenBank Accession Number: BC127716
• Gene Symbol: C1QL3
• Gene ID (NCBI): 389941
• RRID: AB_3742535
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q5VWW1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

C1Q-like (C1QL) proteins bind to the adhesion G protein coupled receptor B3 (ADGRB3) and act at synapses in a subset of circuits. Complement C1q-like 3 (C1QL3, also known as CTRP13) is one of the C1QL proteins. Some C1QL3 migrated as a monomer (~26 kDa) and some as a trimer (60-70 kDa), indicating a desired substantial yet incomplete crosslinking of monomers (PMID: 33337553). The doublet band of trimer probably represents differential posttranslational modifications (PMID: 21378161). Bands of larger molecular weights suggested either trimers cross-linked into higher molecular weight oligomers or C1QL3 cross-linked to binding partners (PMID: 33337553).