C1r Polyclonal antibody

• 

  WB analysis using 17346-1-AP

  human plasma was subjected to SDS PAGE followed by western blot with 17346-1-AP (C1r antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human blood using 17346-1-AP

  Human blood was subjected to SDS PAGE, followed by western blot with 17346-1-AP (C1r Antibody) at a dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver using 17346-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 17346-1-AP (C1r Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human liver using 17346-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 17346-1-AP (C1R Antibody) at dilution of 1:200 (under 40x lens).

C1r Polyclonal Antibody for WB, IHC, ELISA

Cat No. 17346-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IP, ELISA

Synonyms

Complement C1r, Complement C1r subcomponent, Complement C1r subcomponent heavy chain, Complement C1r subcomponent light chain, EC:3.4.21.41

---

Tested Applications

• Positive WB detected in: human plasma, human blood
• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IHC: See 1 publications below
• IP: See 1 publications below

Product Information

17346-1-AP targets C1r in WB, IHC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11390

  Product name: Recombinant human C1R protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 356-705 aa of BC035220

  Sequence: AVCQDDGTWHRAMPRCKIKDCGQPRNLPNGDFRYTTTMGVNTYKARIQYYCHEPYYKMQTRAGSRESEQGVYTCTAQGIWKNEQKGEKIPRCLPVCGKPVNPVEQRQRIIGGQKAKMGNFPWQVFTNIHGRGGGALLGDRWILTAAHTLYPKEHEAQSNASLDVFLGHTNVEELMKLGNHPIRRVSVHPDYRQDESYNFEGDIALLELENSVTLGPNLLPICLPDNDTFYDLGLMGYVSGFGVMEEKIAHDLRFVRLPVANPQACENWLRGKNRMDVFSQNMFCAGHPSLKQDACQGDSGGVFAVRDPNTDRWVATGIVSWGIGCSRGYGFYTKVLNYVDWIKKEMEEED

• Full Name: complement component 1, r subcomponent
• Calculated Molecular Weight: 705 aa, 80 kDa
• Observed Molecular Weight: 85 kDa, 30 kDa
• GenBank Accession Number: BC035220
• Gene Symbol: C1R
• Gene ID (NCBI): 715
• RRID: AB_2878392
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P00736
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The first component of complement is a calcium-dependent complex of the 3 subcomponents C1q, C1r, and C1s. The serine protease subunits C1r and C1s form a Ca(2+)-dependent C1s-C1r-C1r-C1s tetramer. C1r acts by transforming the activation signal into an enzymic activity. C1r is a single-chain glycoprotein that can be cleaved into an A chain and a B chain upon activation. This antibody recognizes the full-length C1r chain and the cleaved B chain.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB,IP,IHC	Mol Carcinog; Downregulation of C1R promotes hepatocellular carcinoma development by activating HIF-1α-regulated glycolysis; Authors - Yuying Ma
human	WB	Sci Rep; C-reactive protein (CRP) recognizes uric acid crystals and recruits proteases C1 and MASP1.; Authors - Anika Alberts