C1orf109 Polyclonal antibody, PBS Only

Name: C1orf109 Polyclonal antibody, PBS Only,
Brand: Proteintech

C1orf109 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 25552-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

AFG2-interacting ribosome maturation factor, AIRIM, Ribosome biogenesis protein C1orf109

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

SKU:

Freight/Packing: -

Quantity

- +

Filter: AllWB

WB analysis using 25552-1-AP (same clone as 25552-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 25552-1-AP (C1orf109 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25552-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of LNCaP using 25552-1-AP (same clone as 25552-1-PBS)
WB result of C1orf109 antibody (25552-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-C1orf109 transfected LNCaP cells. This data was developed using the same antibody clone with 25552-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

25552-1-PBS targets C1orf109 in WB, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag22147 Product name: Recombinant human C1orf109 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-113 aa of BC018109 Sequence: MTQDRPLLAVQEALKKCFPVVEEQQGLWQSALRDCQPLLSSLSNLAEQLQAAQNLRFEDVPALRAFPDLKERLRQPSSSRCETWSAAMWSECFRSMSNTQTQLALMLSCSLQQ Predict reactive species
Full Name	chromosome 1 open reading frame 109
Calculated Molecular Weight	203 aa, 23 kDa
Observed Molecular Weight	23 kDa
GenBank Accession Number	BC018109
Gene Symbol	C1orf109
Gene ID (NCBI)	54955
RRID	AB_3669483
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9NX04
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.