C1orf122 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• C1orf122 Polyclonal antibody (31471-1-AP)

• 

  WB analysis of HEK-293 using 31471-1-AP

  WB result of C1orf122 antibody (31471-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-C1orf122 transfected HEK-293 cells.

• 

  WB analysis using 31471-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31471-1-AP (C1orf122 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

C1orf122 Polyclonal Antibody for WB, ELISA

Cat No. 31471-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

ALAESM, Protein ALAESM

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31471-1-AP targets C1orf122 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35685

  Product name: Recombinant human C1orf122 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-110 aa of NM_198446.2

  Sequence: MEWGPGSDWSRGEAAGVDRGKAGLGLGGRPPPQPPREERAQQLLDAVEQRQRQLLDTIAACEEMLRQLGRRRPEPAGGGNVSAKPGAPPQPAVSARGGFPKDAGDGAAEP

• Full Name: chromosome 1 open reading frame 122
• Calculated Molecular Weight: 11kDa，110aa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: NM_198446.2
• Gene Symbol: C1orf122
• Gene ID (NCBI): 127687
• RRID: AB_3742434
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q6ZSJ8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

C1orf122 (also known as ALAESM) is a lysosomal transmembrane protein and a member of the α/β hydrolase superfamily. It catalyzes the deacylation of cardiolipin to generate monolysocardiolipin (MLCL) within cells, serving as a key node in the mitochondrial cardiolipin remodeling pathway. Clinical multi-omics studies have revealed its significant overexpression in more than ten types of tumors, including hepatocellular carcinoma, glioma, and gastric cancer, which is closely associated with shorter patient survival, immune infiltration, and activation of DNA damage repair pathways. In vitro experiments have confirmed that it promotes cancer cell proliferation and migration by inhibiting apoptosis, inducing epithelial-mesenchymal transition (EMT), and activating the PI3K/AKT/GSK3β-SRPK1 axis. It is regarded as a potential independent prognostic biomarker and therapeutic target.