METTL18 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• METTL18 Polyclonal antibody (25553-1-AP)

METTL18 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 25553-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

C1orf156, Arsenic-transactivated protein 2, AsTP2, EC:2.1.1.85, Histidine protein methyltransferase 1 homolog

• 

  WB analysis of A431 using 25553-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 25553-1-AP (C1orf156 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of PC-3 using 25553-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 25553-1-AP (C1orf156 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A431 using 25553-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using METTL18 antibody (25553-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for METTL18 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A431 cells, PC-3 cells
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25553-1-AP targets METTL18 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22148

  Product name: Recombinant human C1orf156 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-372 aa of BC008679

  Sequence: MTFQFNFTIEDHLENELTPIRDGALTLDSSKELSVSESQKGEERDRKCSAEQFDLPQDHLWEHKSMENAAPSQDTDSPLSAASSSRNLEPHGKQPSLRAAKEHAMPKDLKKMLENKVIETLPGFQHVKLSVVKTILLKENFPGENIVSKSFSSHSDLITGVYEGGLKIWECTFDLLAYFTKAKVKFAGKKVLDLGCGSGLLGITAFKGGSKEIHFQDYNSMVIDEVTLPNVVANSTLEDEENDVNEPDVKRCRKPKVTQLYKCRFFSGEWSEFCKLVLSSEKLFVKYDLILTSETIYNPDYYSNLHQTFLRLLSKNGRVLLASKAHYFGVGGGVHLFQKFVEERDVFKTRILKIIDEGLKRFIIEITFKFPG

• Full Name: chromosome 1 open reading frame 156
• Calculated Molecular Weight: 372 aa, 42 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC008679
• Gene Symbol: METTL18
• Gene ID (NCBI): 92342
• RRID: AB_2880129
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95568
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

METTL18 belongs to a family of protein lysine methyltransferases that methylate nonhistone proteins. Methyltransferases catalyze the transfer of a methyl group from a donor, generally S-adenosyl-L-methionine, to acceptor molecules, including proteins, DNA, RNA, lipids, and small metabolites. METTL18 is involved in peptidyl-lysine monomethylation.

Publications

What published studies show

The METTL18 Polyclonal antibody (Cat# 25553-1-AP) has 2 citations. One appears in Frontiers in Oncology (2021), investigating METTL18 as a prognosis biomarker associated with immune infiltrates in hepatocellular carcinoma. The other is published in eLife (2022), studying METTL18-mediated histidine methylation of RPL3 in translation elongation and proteostasis maintenance. Both citations use Western blot in human samples, spanning research fields of oncology and molecular biology.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Front Oncol; Identification METTL18 as a Potential Prognosis Biomarker and Associated With Immune Infiltrates in Hepatocellular Carcinoma.; Authors - Tian-Hao Li
human	WB	Elife; METTL18-mediated histidine methylation of RPL3 modulates translation elongation for proteostasis maintenance.; Authors - Eriko Matsuura-Suzuki