C1orf216 Polyclonal antibody

• 

  WB analysis of HL-60 using 26265-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 26265-1-AP (C1orf216 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

C1orf216 Polyclonal Antibody for WB, ELISA

Cat No. 26265-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

C1orf216, UPF0500 protein C1orf216

---

Tested Applications

• Positive WB detected in: HL-60 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26265-1-AP targets C1orf216 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22665

  Product name: Recombinant human C1orf216 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-229 aa of BC026909

  Sequence: MFAIQPGLAEGGQFLGDPPPGLCQPELQPDSNSNFMASAKDANENWHGMPGRVEPILRRSSSESPSDNQAFQAPGSPEEGVRSPPEGAEIPGAEPEKMGGAGTVCSPLEDNGYASSSLSIDSRSSSPEPACGTPRGPGPPDPLLPSVAQAVQHLQVQERYKEQEKEKHHVHLVMYRRLALLQWIRGLQHQLIDQQARLQESFDTILDNRKELIRCLQQRAAPSRPQDQA

• Full Name: chromosome 1 open reading frame 216
• Calculated Molecular Weight: 229 aa, 25 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC026909
• Gene Symbol: C1orf216
• Gene ID (NCBI): 127703
• RRID: AB_2880452
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8TAB5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.