C1orf50 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• C1orf50 Polyclonal antibody, PBS Only (20957-1-PBS)

• 

  WB analysis of HEK-293 using 20957-1-AP (same clone as 20957-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 20957-1-AP (C1orf50 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20957-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human testis using 20957-1-AP (same clone as 20957-1-PBS)

  human testis tissue were subjected to SDS PAGE followed by western blot with 20957-1-AP (C1orf50 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20957-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 20957-1-AP (same clone as 20957-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 20957-1-AP (C1orf50 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20957-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 20957-1-AP (same clone as 20957-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 20957-1-AP (C1orf50 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20957-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 20957-1-AP (same clone as 20957-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 20957-1-AP (C1orf50 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 20957-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 20957-1-AP (same clone as 20957-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 20957-1-AP (C1orf50 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 20957-1-PBS in a different storage buffer formulation.

C1orf50 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 20957-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

chromosome 1 open reading frame 50

---

Product Information

20957-1-PBS targets C1orf50 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15124

  Product name: Recombinant human C1orf50 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-199 aa of BC001711

  Sequence: MEDAAAPGRTEGVLERQGAPPAAGQGGALVELTPTPGGLALVSPYHTHRAGDPLDLVALAEQVQKADEFIRANATNKLTVIAEQIQHLQEQARKVLEDAHRDANLHHVACNIVKKPGNIYYLYKRESGQQYFSIISPKEWGTSCPHDFLGAYKLQHDLSWTPYEDIEKQDAKISMMDMLLSQSVALPPCTEPNFQGLTH

• Full Name: chromosome 1 open reading frame 50
• Calculated Molecular Weight: 199 aa, 22 kDa
• Observed Molecular Weight: 26 kDa
• GenBank Accession Number: BC001711
• Gene Symbol: C1orf50
• Gene ID (NCBI): 79078
• RRID: AB_10733340
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BV19
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.