C1orf54 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• C1orf54 Polyclonal antibody, PBS Only (30247-1-PBS)

C1orf54 Polyclonal Antibody for IHC, IF-P, Indirect ELISA

Cat No. 30247-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF-P, Indirect ELISA

Synonyms

• 

  IHC staining of mouse kidney using 30247-1-AP (same clone as 30247-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 30247-1-AP (C1orf54 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30247-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 30247-1-AP (same clone as 30247-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 30247-1-AP (C1orf54 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30247-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse kidney using 30247-1-AP (same clone as 30247-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse kidney tissue using C1orf54 antibody (30247-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 30247-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse kidney using 30247-1-AP (same clone as 30247-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse kidney tissue using C1orf54 antibody (30247-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 30247-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

30247-1-PBS targets C1orf54 in IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32876

  Product name: Recombinant human C1orf54 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 17-131 aa of BC017761

  Sequence: QEYEDEERLGEDEYYQVVYYYTVTPSYDDFSADFTIDYSIFESEDRLNRLDKDITEAIETTISLETARADHPKPVTVKPVTTEPSPDLNDAVSSLRSPIPLLLSCAFVQVGMYFM

• Full Name: chromosome 1 open reading frame 54
• GenBank Accession Number: BC017761
• Gene Symbol: C1orf54
• Gene ID (NCBI): 79630
• RRID: AB_3086279
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WWF1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

C1orf54 is a newly identified protein encoded by an open reading frame on chromosome 1. C1orf54 is highly expressed in healthy mouse kidneys and is only expressed in tubular epithelial cells (TECs), not in glomeruli(PMID: 29999589). C1orf54 promotes renal repair and TEC proliferation through PI3K/AKT signalling, which alleviates kidney damage after ischaemia‐reperfusion injury (IRI) (PMID: 29999589).