Complement C2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Complement C2 Polyclonal antibody (27175-1-AP)

Complement C2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27175-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

C2, complement component 2, Complement C2b fragment, Complement C2a fragment, CO2

• 

  WB analysis of A431 using 27175-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 27175-1-AP (C2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 27175-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 27175-1-AP (C2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Raji using 27175-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 27175-1-AP (C2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 27175-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 27175-1-AP (C2 Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 27175-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 27175-1-AP (C2 Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Complement C2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A431 cells, HepG2 cells, Raji cells
• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27175-1-AP targets Complement C2 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25690

  Product name: Recombinant human C2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 587-726 aa of BC043484

  Sequence: EANLALRRPQGSTCRDHENELLNKQSVPAHFVALNGSKLNINLKMGVEWTSCAEVVSQEKTMFPNLTDVREVVTDQFLCSGTQEDESPCKGESGGAVFLERRFRFFQVGLVSWGLYNPCLGSADKNSRKRAPRSKVPPPR

• Full Name: complement component 2
• Observed Molecular Weight: 70 kDa, 80 kDa
• GenBank Accession Number: BC043484
• Gene Symbol: C2
• Gene ID (NCBI): 717
• RRID: AB_2880787
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P06681
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Complement C2 (C2) is a key component of the classical and lectin pathways of the complement system. Complement C2 deficiency is associated with an increased susceptibility to infections, particularly those caused by encapsulated bacteria.

Publications

What published studies show

The Complement C2 Polyclonal antibody (Cat# 27175-1-AP) has 2 total citations. These appear in Cell Mol Gastroenterol Hepatol (IF 8.2), where it was used in WB to study mitochondrial DNA variants and gallstone disease, and in Insect Biochem Mol Biol (IF 4.3), where it was applied in IHC for sequence analysis of mosquito and Drosophila orthologs. The associated research fields span gastroenterology/mitochondrial biology and insect molecular biology.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Mol Gastroenterol Hepatol; A Mitochondrial DNA Variant Elevates the Risk of Gallstone Disease by Altering Mitochondrial Function.; Authors - Dayan Sun
	IHC	Insect Biochem Mol Biol; Sequence analysis and function of mosquito aeCCC2 and Drosophila Ncc83 orthologs.; Authors - Phu C Duong