MIS18A Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MIS18A Polyclonal antibody (25832-1-AP)

• KD/KO Validated

MIS18A Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 25832-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, IP, ELISA

Synonyms

C21orf45, B28, C21orf46, FAPP1 associated protein 1, FAPP1-associated protein 1

• 

  WB analysis of HeLa using 25832-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 25832-1-AP (C21orf45 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 25832-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25832-1-AP (MIS18A antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 25832-1-AP

  WB result of MIS18A antibody (25832-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-MIS18A transfected Jurkat cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of Jurkat using 25832-1-AP

  IP result of anti-MIS18A (IP:25832-1-AP, 4ug; Detection:25832-1-AP 1:500) with Jurkat cells lysate 1280 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 25832-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HepG2 cells using C21orf45 antibody (25832-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MIS18A in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293T cells, HeLa cells, Jurkat cells
• Positive IP detected in: Jurkat cells
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25832-1-AP targets MIS18A in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22922

  Product name: Recombinant human C21orf45 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-233 aa of BC042917

  Sequence: MAGVRSLRCSRGCAGGCECGDKGKCSDSSLLGKRLSEDSSRHQLLQKWASMWSSMSEDASVADMERAQLEEEAAAAEERPLVFLCSGCRRPLGDSLSWVASQEDTNCILLRCVSCNVSVDKEQKLSKREKENGCVLETLCCAGCSLNLGYVYRCTPKNLDYKRDLFCLSVEAIESYVLGSSEKQIVSEDKELFNLESRVEIEKSLTQMEDVLKALQMKLWEAESKLSFATCKS

• Full Name: chromosome 21 open reading frame 45
• Calculated Molecular Weight: 233 aa, 26 kDa
• Observed Molecular Weight: 26 kDa,28 kDa
• GenBank Accession Number: BC042917
• Gene Symbol: C21orf45
• Gene ID (NCBI): 54069
• RRID: AB_2880259
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NYP9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

C21orf45, also named as MIS18A, C21orf46 and FASP1, is required for recruitment of CENPA to centromeres and normal chromosome segregation during mitosis. C21orf45 has dimer(~52 kDa) and heterodimer(~105 kDa) forms.

Publications

What published studies show

The MIS18A Polyclonal antibody (Cat# 25832-1-AP) has 1 citation. It was cited in British Journal of Pharmacology (2021), in a study investigating how nuclear translocation of ATG5 induces DNA mismatch repair deficiency and microsatellite instability through interaction with Mis18α in colorectal cancer. The research falls within the fields of cancer biology, DNA repair, and chromosomal segregation.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB,IF	Br J Pharmacol; Nuclear translocation of ATG5 induces DNA mismatch repair deficiency (MMR-D)/microsatellite instability (MSI) via interacting to Mis18α in colorectal cancer.; Authors - Shi-Yue Sun