C21orf59 Polyclonal antibody

• 

  WB analysis of K-562 using 21461-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 21461-1-AP (C21orf59 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 21461-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 21461-1-AP (C21orf59 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of PC-3 using 21461-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 21461-1-AP (C21orf59 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 21461-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 21461-1-AP (C21orf59 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 21461-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 21461-1-AP (C21orf59 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HEK-293 using 21461-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using C21orf59 antibody (21461-1-AP) at dilution of 1:200 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4).

C21orf59 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 21461-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

Protein kurly homolog, C21orf48

---

Tested Applications

• Positive WB detected in: K-562 cells, HeLa cells, MCF-7 cells, PC-3 cells
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

21461-1-AP targets C21orf59 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14994

  Product name: Recombinant human C21orf59 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-290 aa of BC000709

  Sequence: MVLLHVKRGDESQFLLQAPGSTELEELTVQVARVYNGRLKVQRLCSEMEELAEHGIFLPPNMQGLTDDQIEELKLKDEWGEKCVPSGGAVFKKDDIGRRNGQAPNEKMKQVLKKTIEEAKAIISKKQVEAGVCVTMEMVKDALDQLRGAVMIVYPMGLPPYDPIRMEFENKEDLSGTQAGLNVIKEAEAQLWWAAKELRRTKKLSDYVGKNEKTKIIAKIQQRGQGAPAREPIISSEEQKQLMLYYHRRQEELKRLEENDDDAYLNSPWADNTALKRHFHGVKDIKWRPR

• Full Name: chromosome 21 open reading frame 59
• Calculated Molecular Weight: 290 aa, 33 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC000709
• Gene Symbol: C21orf59
• Gene ID (NCBI): 56683
• RRID: AB_2878863
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P57076
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cell; FACS-based genome-wide CRISPR screens define key regulators of DNA damage signaling pathways; Authors - Min Huang