C4 Gamma Chain Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• C4 Gamma Chain Polyclonal antibody, PBS Only (17160-1-PBS)

• 

  WB analysis of human plasma using 17160-1-AP (same clone as 17160-1-PBS)

  human plasma were subjected to SDS PAGE followed by western blot with 17160-1-AP (C4 Gamma Chain antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17160-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 17160-1-AP (same clone as 17160-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 17160-1-AP (C4 Gamma Chain antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17160-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 17160-1-AP (same clone as 17160-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 17160-1-AP (C4 Gamma Chain antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17160-1-PBS in a different storage buffer formulation.

C4 Gamma Chain Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 17160-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

17160-1-PBS targets C4 Gamma Chain in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10449

  Product name: Recombinant human C4A protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-202 aa of BC012372

  Sequence: EVPVGLVQPASATLYDYYNPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYYPRVEYGFQVKVLREGSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLESNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQGCQV

• Full Name: complement component 4A (Rodgers blood group)
• Calculated Molecular Weight: 1744 aa, 193 kDa
• Observed Molecular Weight: 30-35 kDa
• GenBank Accession Number: BC012372
• Gene Symbol: C4 Gamma Chain
• Gene ID (NCBI): 720
• RRID: AB_2923565
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P0C0L4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Complement C4, a component of the classical complement pathway, has an important role in innate immune function. C4 protein is expressed as a single chain precursor which is proteolytically cleaved into a trimer of alpha, beta, and gamma chains (molecular weights 95, 78, and 31 kDa) prior to secretion. The alpha chain is cleaved to release C4 anaphylatoxin, an antimicrobial peptide and a mediator of local inflammation. This antibody raised against 1543-1744aa of human C4A protein recognizes the C4 gamma chain.