C4 Gamma Chain Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• C4 Gamma Chain Polyclonal antibody, PBS Only (17160-1-PBS)

C4 Gamma Chain Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 17160-1-PBS Copied!

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

C4 (gamma chain), C4A, Acidic complement C4, C3 and PZP-like alpha-2-macroglobulin domain-containing protein 2, C4

• 

  WB analysis of human plasma using 17160-1-AP (same clone as 17160-1-PBS)

  human plasma were subjected to SDS PAGE followed by western blot with 17160-1-AP (C4 Gamma Chain antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17160-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 17160-1-AP (same clone as 17160-1-PBS)

  WB result of C4 Gamma Chain antibody (17160-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-C4 Gamma Chain transfected HepG2 cells. This data was developed using the same antibody clone with 17160-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 17160-1-AP (same clone as 17160-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 17160-1-AP (C4 Gamma Chain antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17160-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 17160-1-AP (same clone as 17160-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 17160-1-AP (C4 Gamma Chain antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17160-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for C4 Gamma Chain in ?

Chat with Able

---

Product Information

17160-1-PBS targets C4 Gamma Chain in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10449

  Product name: Recombinant human C4A protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1543-1744 aa of NM_001252204

  Sequence: EVPVGLVQPASATLYDYYNPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYYPRVEYGFQVKVLREGSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLESNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQGCQV

• Full Name: complement component 4A (Rodgers blood group)
• Calculated Molecular Weight: 1744 aa, 193 kDa
• Observed Molecular Weight: ~190 kDa, 30-35 kDa
• GenBank Accession Number: NM_001252204
• Gene Symbol: C4 Gamma Chain
• Gene ID (NCBI): 720
• RRID: AB_2923565
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P0C0L4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Complement C4, a component of the classical complement pathway, has an important role in innate immune function. C4 protein is expressed as a single-chain precursor that is proteolytically cleaved into a trimer of alpha, beta, and gamma chains (molecular weights 95, 78, and 31 kDa) prior to secretion. The alpha chain is cleaved to release C4 anaphylatoxin, an antimicrobial peptide and a mediator of local inflammation. This antibody, raised against 1543-1744aa of human C4A protein, recognizes the C4 gamma chain.