C4 Gamma Chain Polyclonal antibody

• 

  WB analysis of human plasma using 17160-1-AP

  human plasma were subjected to SDS PAGE followed by western blot with 17160-1-AP (C4 Gamma Chain antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 17160-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 17160-1-AP (C4 Gamma Chain antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 17160-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 17160-1-AP (C4 Gamma Chain antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

C4 Gamma Chain Polyclonal Antibody for WB, IHC, ELISA

Cat No. 17160-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

Acidic complement C4, C4, C4 (gamma chain), C4A, C4A2, C4A3, C4A4, C4A6, C4S, CO4, Complement C4 A, CPAMD2, RG

---

Tested Applications

• Positive WB detected in: human plasma
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17160-1-AP targets C4 Gamma Chain in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10449

  Product name: Recombinant human C4A protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-202 aa of BC012372

  Sequence: EVPVGLVQPASATLYDYYNPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYYPRVEYGFQVKVLREGSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLESNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQGCQV

• Full Name: complement component 4A (Rodgers blood group)
• Calculated Molecular Weight: 1744 aa, 193 kDa
• Observed Molecular Weight: 30-35 kDa
• GenBank Accession Number: BC012372
• Gene Symbol: C4 Gamma Chain
• Gene ID (NCBI): 720
• RRID: AB_2923565
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P0C0L4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Complement C4, a component of the classical complement pathway, has an important role in innate immune function. C4 protein is expressed as a single chain precursor which is proteolytically cleaved into a trimer of alpha, beta, and gamma chains (molecular weights 95, 78, and 31 kDa) prior to secretion. The alpha chain is cleaved to release C4 anaphylatoxin, an antimicrobial peptide and a mediator of local inflammation. This antibody raised against 1543-1744aa of human C4A protein recognizes the C4 gamma chain.