C4 Gamma Chain Monoclonal antibody, PBS Only

• 

  WB analysis of human plasma using 66242-1-Ig (same clone as 66242-1-PBS)

  human plasma were subjected to SDS PAGE followed by western blot with 66242-1-Ig (C4 gamma chain antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66242-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 66242-1-Ig (same clone as 66242-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66242-1-Ig (C4 gamma chain antibody) at dilution of 1:800 (under 10x lens). This data was developed using the same antibody clone with 66242-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 66242-1-Ig (same clone as 66242-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66242-1-Ig (C4 gamma chain antibody) at dilution of 1:800 (under 40x lens). This data was developed using the same antibody clone with 66242-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human liver using 66242-1-Ig (same clone as 66242-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human liver tissue using C4 Gamma Chain antibody (66242-1-Ig, Clone: 2G6A7 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66242-1-PBS in a different storage buffer formulation.

C4 Gamma Chain Monoclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 66242-1-PBS

Clone No.2G6A7

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

C4 (gamma chain), C4A, Acidic complement C4, C3 and PZP-like alpha-2-macroglobulin domain-containing protein 2, C4

---

Product Information

66242-1-PBS targets C4 Gamma Chain in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10449

  Product name: Recombinant human C4A protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-202 aa of BC012372

  Sequence: EVPVGLVQPASATLYDYYNPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYYPRVEYGFQVKVLREGSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLESNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQGCQV

• Full Name: complement component 4A (Rodgers blood group)
• Calculated Molecular Weight: 1744 aa, 193 kDa
• Observed Molecular Weight: 31 kDa
• GenBank Accession Number: BC012372
• Gene Symbol: C4 Gamma Chain
• Gene ID (NCBI): 720
• RRID: AB_2881631
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P0C0L4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Complement C4, a component of the classical complement pathway, has an important role in innate immune function. C4 protein is expressed as a single chain precursor which is proteolytically cleaved into a trimer of alpha, beta, and gamma chains (molecular wights 95, 78, and 31 kDa) prior to secretion. The alpha chain is cleaved to release C4 anaphylatoxin, an antimicrobial peptide and a mediator of local inflammation. This antibody raised against 1543-1744aa of human C4-A protein recognizes C4 gamma chain.