CoraLite® Plus 488-conjugated C4 Gamma Chain Monoclonal antibody

C4 Gamma Chain Monoclonal Antibody for IF-P
Cat No. CL488-66242
Clone No.2G6A7

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF-P

C4A, C4 (gamma chain), C4, C3 and PZP-like alpha-2-macroglobulin domain-containing protein 2, Acidic complement C4

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse liver tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66242 targets C4 Gamma Chain in IF-P applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag10449

Product name: Recombinant human C4A protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-202 aa of BC012372

Sequence: EVPVGLVQPASATLYDYYNPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYYPRVEYGFQVKVLREGSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLESNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQGCQV

Predict reactive species
Full Name complement component 4A (Rodgers blood group)
Calculated Molecular Weight 1744 aa, 193 kDa
Observed Molecular Weight 31 kDa
GenBank Accession NumberBC012372
Gene Symbol C4 Gamma Chain
Gene ID (NCBI) 720
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP0C0L4
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Complement C4, a component of the classical complement pathway, has an important role in innate immune function. C4 protein is expressed as a single chain precursor which is proteolytically cleaved into a trimer of alpha, beta, and gamma chains (molecular wights 95, 78, and 31 kDa) prior to secretion. The alpha chain is cleaved to release C4 anaphylatoxin, an antimicrobial peptide and a mediator of local inflammation. This antibody raised against 1543-1744aa of human C4-A protein recognizes C4 gamma chain.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 C4 Gamma Chain antibody CL488-66242Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...