C4orf7 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• C4orf7 Polyclonal antibody, PBS Only (26057-1-PBS)

• 

  WB analysis of K-562 using 26057-1-AP (same clone as 26057-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 26057-1-AP (C4orf7 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26057-1-PBS in a different storage buffer formulation.

C4orf7 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 26057-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

FDC secreted protein, FDC SP, FDCSP, FDC-SP, UNQ733/PRO1419

---

Product Information

26057-1-PBS targets C4orf7 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22028

  Product name: Recombinant human C4orf7 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 18-85 aa of BC062213

  Sequence: FPVSQDQEREKRSISDSDELASGFFVFPYPYPFRPLPPIPFPRFPWFRRNFPIPIPESAPTTPLPSEK

• Full Name: chromosome 4 open reading frame 7
• Calculated Molecular Weight: 85 aa, 10 kDa
• Observed Molecular Weight: 8 kDa
• GenBank Accession Number: BC062213
• Gene Symbol: C4orf7
• Gene ID (NCBI): 260436
• RRID: AB_2880355
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NFU4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.