Anti-Human C5AR1/CD88 Rabbit Recombinant Antibody, PBS Only

• 

  FC experiment of human peripheral blood leukocytes using 98226-1-RR (same clone as 98226-1-PBS)

  1x10^6 human peripheral blood leukocytes were surface stained with 0.25 ug Anti-Human C5AR1/CD88 Rabbit Recombinant Antibody (98226-1-RR, Clone: 241712D4) or 0.25 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were co-stained with CoraLite® Plus 647 Anti-Human CD16. Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed. This data was developed using the same antibody clone with 98226-1-PBS in a different storage buffer formulation.

• 

  FC experiment of human peripheral blood leukocytes using 98226-1-RR (same clone as 98226-1-PBS)

  1x10^6 human peripheral blood leukocytes were surface stained with 0.25 ug Anti-Human C5AR1/CD88 Rabbit Recombinant Antibody (98226-1-RR, Clone: 241712D4) (red) or 0.25 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed. This data was developed using the same antibody clone with 98226-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 98226-1-RR

  Biolayer interferometry (BLl) kinetic assays of 98226-1-RR against Human C5AR1/CD88 were performed. The affinity constant is 1.56 nM.

C5AR1/CD88 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98226-1-PBS

Clone No.241712D4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

C5AR, C5AR1, 241712D4, C5A, C5a anaphylatoxin chemotactic receptor 1

---

Product Information

98226-1-PBS targets C5AR1/CD88 in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2185

  Product name: Recombinant Human C5AR1/CD88 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 1-37 aa of NM_001736.4

  Sequence: MDSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPD

• Full Name: complement component 5a receptor 1
• Calculated Molecular Weight: 39kDa
• GenBank Accession Number: NM_001736.4
• Gene Symbol: C5aR
• Gene ID (NCBI): 728
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P21730
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

C5aR, also named CD88, is a G protein-coupled receptor for the anaphylatoxin C5a, a cleavage product of the complement cascade. The C5a ligand is a proinflammatory component of host defense. C5aR is activated upon binding of the C5a molecule. Receptor activation stimulates chemotaxis, granule enzyme release, intracellular calcium release, and superoxide anion production.