• Zero Fc receptor binding
  • Site-specific conjugation
  • One universal isotype

FcZero-rAb™ APC Anti-Human C5AR1/CD88 Rabbit Recombinant Antibody

C5AR1/CD88 FcZero-rAbTM Recombinant Antibody for FC
Cat No. APC-FcA98226
Clone No.241712D4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

C5AR, C5AR1, C5A, C5a anaphylatoxin chemotactic receptor 1, C5a R

Formulation:  PBS, Azide, BSA
PBS, Azide, BSA
Conjugate:  APC
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inhuman peripheral blood leukocytes

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 5 ul per 10^6 cells in a 100 µl suspension
This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.
Sample-dependent, Check data in validation data gallery.

Product Information

APC-FcA98226 targets C5AR1/CD88 in FC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg2185

Product name: Recombinant Human C5AR1/CD88 protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 1-37 aa of NM_001736.4

Sequence: MDSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPD

Predict reactive species
Full Name complement component 5a receptor 1
Calculated Molecular Weight39kDa
GenBank Accession NumberNM_001736.4
Gene Symbol C5aR
Gene ID (NCBI) 728
Conjugate APC Fluorescent Dye
Excitation/Emission Maxima Wavelengths650 nm / 660 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP21730
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

C5aR, also named CD88, is a G protein-coupled receptor for the anaphylatoxin C5a, a cleavage product of the complement cascade. The C5a ligand is a proinflammatory component of host defense. C5aR is activated upon binding of the C5a molecule. Receptor activation stimulates chemotaxis, granule enzyme release, intracellular calcium release, and superoxide anion production.

Protocols

Product Specific Protocols
FC protocol for APC C5AR1/CD88 antibody APC-FcA98226Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...