Home
Products
Primary Antibodies
C5orf51 Polyclonal antibody, PBS Only (30107-1-PBS)

Filter: AllWBIHCIF/ICC

WB analysis using 30107-1-AP (same clone as 30107-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 30107-1-AP (C5orf51 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30107-1-PBS in a different storage buffer formulation.
WB analysis using 30107-1-AP (same clone as 30107-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 30107-1-AP (C5orf51 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30107-1-PBS in a different storage buffer formulation.
IHC staining of mouse liver using 30107-1-AP (same clone as 30107-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 30107-1-AP (C5orf51 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30107-1-PBS in a different storage buffer formulation.
IHC staining of mouse liver using 30107-1-AP (same clone as 30107-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 30107-1-AP (C5orf51 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30107-1-PBS in a different storage buffer formulation.
IF Staining of HeLa using 30107-1-AP (same clone as 30107-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed HeLa cells using C5orf51 antibody (30107-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 30107-1-PBS in a different storage buffer formulation.
IF Staining of HeLa using 30107-1-AP (same clone as 30107-1-PBS)
Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using C5orf51 antibody (30107-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 30107-1-PBS in a different storage buffer formulation.

C5orf51 Polyclonal antibody, PBS Only

Name: C5orf51 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 30107-1-PBS

C5orf51 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 30107-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

30107-1-PBS targets C5orf51 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag32440 Product name: Recombinant human C5orf51 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 203-293 aa of XM_011514032 Sequence: FSDIHLLAMMYSGEMCYWGSKYCADQQPENHEVDTSVSGAGCTTYKEPLDFREVGEKILKKYVSVCEGPLKEQEWNTTNAKQILNFFHHRCN Predict reactive species
Full Name	chromosome 5 open reading frame 51
Calculated Molecular Weight	34kd
Observed Molecular Weight	34-40 kDa
GenBank Accession Number	XM_011514032
Gene Symbol	C5orf51
Gene ID (NCBI)	285636
RRID	AB_3086230
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	A6NDU8
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.