C6orf130 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• C6orf130 Recombinant monoclonal antibody, PBS Only (83500-4-PBS)

• 

  WB analysis using 83500-4-RR (same clone as 83500-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83500-4-RR (C6orf130 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83500-4-PBS in a different storage buffer formulation.

• 

  FC experiment of A431 using 83500-4-RR (same clone as 83500-4-PBS)

  1x10^6 A431 cells were intracellularly stained with 0.25 ug C6orf130 Recombinant antibody (83500-4-RR, Clone:240455D7) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 83500-4-PBS in a different storage buffer formulation.

• 

  FC experiment of PC-3 using 83500-4-RR (same clone as 83500-4-PBS)

  1x10^6 PC-3 cells were intracellularly stained with 0.25 ug C6orf130 Recombinant antibody (83500-4-RR, Clone:240455D7) and APC-Conjugated Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Rabbit IgG Isotype Control Recombinant Antibody (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed and permeabilized with True-Nuclear Transcription Factor Buffer Set. This data was developed using the same antibody clone with 83500-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83500-4-RR

  Biolayer interferometry (BLl) kinetic assays of 83500-4-RR against Human C6orf130 were performed. The affinity constant is below 1 pM.

C6orf130 Uni-rAb^® Recombinant Antibody for WB, FC (Intra), ELISA

Cat No. 83500-4-PBS

Clone No.240455D7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), ELISA

Synonyms

OARD1, [Protein ADP-ribosylglutamate] hydrolase OARD1, 240455D7, ADP-ribose glycohydrolase OARD1, EC:3.2.2.-

---

Product Information

83500-4-PBS targets C6orf130 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag19341

  Product name: Recombinant human C6orf130 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-152 aa of BC011709

  Sequence: MASSLNEDPEGSRITYVKGDLFACPKTDSLAHCISEDCRMGAGIAVLFKKKFGGVQELLNQQKKSGEVAVLKRDGRYIYYLITKKRASHKPTYENLQKSLEAMKSHCLKNGVTDLSMPRIGCGLDRLQWENVSAMIEEVFEATDIKITVYTL

• Full Name: chromosome 6 open reading frame 130
• Calculated Molecular Weight: 152 aa, 17 kDa
• Observed Molecular Weight: 17 kDa
• GenBank Accession Number: BC011709
• Gene Symbol: C6orf130
• Gene ID (NCBI): 221443
• RRID: AB_3671126
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9Y530
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

OARD1 (O-acetyl-ADP-ribose deacetylase 1), also known as TARG1 (Terminal ADP-ribose protein glycohydrolase 1) and C6orf130, is a ADP-ribose glycohydrolase that hydrolyzes ADP-ribose and acts on different substrates, such as proteins ADP-ribosylated on glutamate and O-acetyl-ADP-D-ribose (PMID: 21849506; 23474714; 23481255). The MW of this protein is 17 kDa, and this antibody specially recognises the 17 kDa protein.