C6orf15 Polyclonal antibody

• 

  WB analysis using 24953-1-AP

  A375 cells were subjected to SDS PAGE followed by western blot with 24953-1-AP (C6orf15 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse skin using 24953-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 24953-1-AP (C6orf15 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skin using 24953-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 24953-1-AP (C6orf15 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A375 using 24953-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed A375 cells using C6orf15 antibody (24953-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-phalloidin (red).

C6orf15 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 24953-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Protein STG, STG, UNQ1840/PRO3566

---

Tested Applications

• Positive WB detected in: A375 cells
• Positive IHC detected in: mouse skin tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A375 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 3 publications below
• IF: See 1 publications below

Product Information

24953-1-AP targets C6orf15 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20276

  Product name: Recombinant human C6orf15 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 27-325 aa of BC153157

  Sequence: RSIGVVEEKVSQNLGTNLPQLGQPSSTGPSNSEHPQPALDPRSNDLARVPLKLSVPASDGFPPAGGSAVQRWPPSWGLPAMDSWPPEDPWQMMAAAAEDRLGEALPEELSYLSSAAALAPGSGPLPGESSPDATGLSPKASLLHQDSESRRLPRSNSLGAGGKILSQRPPWSLIHRVLPDHPWGTLNPSVSWGGGGPGTGWGTRPMPHPEGIWGINNQPPGTSWGNINRYPGGSWGNINRYPGGSWGNINRYPGGSWGNIHLYPGINNPFPPGVLRPPGSSWNIPAGFPNPPSPRLQWG

• Full Name: chromosome 6 open reading frame 15
• Calculated Molecular Weight: 325 aa, 34 kDa
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: BC153157
• Gene Symbol: C6orf15
• Gene ID (NCBI): 29113
• RRID: AB_2879818
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6UXA7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

C6orf15, also named as Protein STG, is a 325 amino acid protein, which as a secreted protein is expressed in skin and tonsils. The calculated molecular weight of C6orf15 is 34 kDa, but we detected a 50-55 kDa protein by western blot. C6orf15 may contains some modified residues.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB,IHC,IF	Cancer Cell Int; C6orf15 promotes liver metastasis via WNT/β-catenin signalling in colorectal cancer; Authors - Jiankang Yu
human	IHC	Pathol Res Pract; C6orf15 acts as a potential novel marker of adverse pathological features and prognosis for colon cancer; Authors - Xiaoyu Xiong
human	IHC	Ann Diagn Pathol; Differential diagnosis of gastric low- and high grade dysplasia using C6orf15 protein; Authors - Leilei Liu