CoraLite® Plus 488-conjugated C6orf15 Polyclonal antibody

• 

  IF Staining of A375 using CL488-24953

  Immunofluorescent analysis of (-20°C Ethanol) fixed A375 cells using CoraLite® Plus 488 C6orf15 antibody (CL488-24953) at dilution of 1:200, CL594-Phalloidin (red).

C6orf15 Polyclonal Antibody for IF/ICC

Cat No. CL488-24953

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

Synonyms

UNQ1840/PRO3566, STG, Protein STG

---

Tested Applications

• Positive IF/ICC detected in: A375 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-24953 targets C6orf15 in IF/ICC applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20276

  Product name: Recombinant human C6orf15 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 27-325 aa of BC153157

  Sequence: RSIGVVEEKVSQNLGTNLPQLGQPSSTGPSNSEHPQPALDPRSNDLARVPLKLSVPASDGFPPAGGSAVQRWPPSWGLPAMDSWPPEDPWQMMAAAAEDRLGEALPEELSYLSSAAALAPGSGPLPGESSPDATGLSPKASLLHQDSESRRLPRSNSLGAGGKILSQRPPWSLIHRVLPDHPWGTLNPSVSWGGGGPGTGWGTRPMPHPEGIWGINNQPPGTSWGNINRYPGGSWGNINRYPGGSWGNINRYPGGSWGNIHLYPGINNPFPPGVLRPPGSSWNIPAGFPNPPSPRLQWG

• Full Name: chromosome 6 open reading frame 15
• Calculated Molecular Weight: 325 aa, 34 kDa
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: BC153157
• Gene Symbol: C6orf15
• Gene ID (NCBI): 29113
• RRID: AB_3672783
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6UXA7
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

C6orf15, also named as Protein STG, is a 325 amino acid protein, which as a secreted protein is expressed in skin and tonsils. The calculated molecular weight of C6orf15 is 34 kDa, but we detected a 50-55 kDa protein by western blot. C6orf15 may contains some modified residues.