C6orf15 Recombinant monoclonal antibody, PBS Only (Detector)

C6orf15 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 85830-1-PBS
Clone No.250126F4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Cytometric bead array, Indirect ELISA

Protein STG, STG, UNQ1840/PRO3566

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85830-1-PBS targets C6orf15 as part of a matched antibody pair:

MP02146-2: 85830-2-PBS capture and 85830-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag20276

Product name: Recombinant human C6orf15 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 27-325 aa of BC153157

Sequence: RSIGVVEEKVSQNLGTNLPQLGQPSSTGPSNSEHPQPALDPRSNDLARVPLKLSVPASDGFPPAGGSAVQRWPPSWGLPAMDSWPPEDPWQMMAAAAEDRLGEALPEELSYLSSAAALAPGSGPLPGESSPDATGLSPKASLLHQDSESRRLPRSNSLGAGGKILSQRPPWSLIHRVLPDHPWGTLNPSVSWGGGGPGTGWGTRPMPHPEGIWGINNQPPGTSWGNINRYPGGSWGNINRYPGGSWGNINRYPGGSWGNIHLYPGINNPFPPGVLRPPGSSWNIPAGFPNPPSPRLQWG

Predict reactive species
Full Name chromosome 6 open reading frame 15
Calculated Molecular Weight 325 aa, 34 kDa
Observed Molecular Weight55 kDa
GenBank Accession NumberBC153157
Gene Symbol C6orf15
Gene ID (NCBI) 29113
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ6UXA7
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

C6orf15, also named as Protein STG, is a 325 amino acid protein, which as a secreted protein is expressed in skin and tonsils. The calculated molecular weight of C6orf15 is 34 kDa, but we detected a 50-55 kDa protein by western blot. C6orf15 may contains some modified residues.

Loading...
||
New chat Able
正在加载,请稍候...