TMEM243 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TMEM243 Polyclonal antibody (20880-1-AP)

• 

  IP experiment of Ramos using 20880-1-AP

  IP result of anti-C7orf23 (IP:20880-1-AP, 4ug; Detection:20880-1-AP 1:800) with Ramos cells lysate 1680 ug.

• 

  IHC staining of human urothelial carcinoma using 20880-1-AP

  Immunohistochemical analysis of paraffin-embedded human urothelial carcinoma tissue slide using 20880-1-AP (TMEM243 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human urothelial carcinoma using 20880-1-AP

  Immunohistochemical analysis of paraffin-embedded human urothelial carcinoma tissue slide using 20880-1-AP (TMEM243 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

TMEM243 Polyclonal Antibody for IHC, IP, ELISA

Cat No. 20880-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IP, ELISA

Synonyms

C7orf23, MM TRAG, Transmembrane Protein 243, Transmembrane protein C7orf23

---

Tested Applications

• Positive IP detected in: Ramos cells
• Positive IHC detected in: human urothelial carcinoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20880-1-AP targets TMEM243 in IHC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14979

  Product name: Recombinant human C7orf23 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-118 aa of BC002837

  Sequence: MEDFATRTYGTSGLDNRPLFGETSAKDRIINLVVGSLTSLLILVTLISAFVFPQLPPKPLNIFFAVCISLSSITACILIYWYRQGDLEPKFRKLIYYIIFSIIMLCICANLYFHDVGR

• Full Name: chromosome 7 open reading frame 23
• Calculated Molecular Weight: 118 aa, 13 kDa
• Observed Molecular Weight: 16 kDa
• GenBank Accession Number: BC002837
• Gene Symbol: C7orf23
• Gene ID (NCBI): 79161
• RRID: AB_3742006
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BU79
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

C7orf23, also known as TMEM243, encodes a membrane protein that may be associated with drug tolerance in cells. The C7orf23 gene is capable of generating at least 12 different splice variants, 10 of which are capable of encoding 7 different protein isoforms, some of which contain transmembrane structural domains. Recent studies have shown that C7orf23 is significantly up-regulated and highly sensitive in blood samples from PD patients, revealing its potential as a future biomarker for PD diagnosis.