MALSU1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MALSU1 Polyclonal antibody, PBS Only (22838-1-PBS)

• 

  WB analysis using 22838-1-AP (same clone as 22838-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 22838-1-AP (C7orf30 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22838-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 22838-1-AP (same clone as 22838-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 22838-1-AP (C7orf30 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22838-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 22838-1-AP (same clone as 22838-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 22838-1-AP (C7orf30 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 22838-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 22838-1-AP (same clone as 22838-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 22838-1-AP (C7orf30 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 22838-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 22838-1-AP (same clone as 22838-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver using 22838-1-AP (C7orf30 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 22838-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 22838-1-AP (same clone as 22838-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver using 22838-1-AP (C7orf30 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 22838-1-PBS in a different storage buffer formulation.

MALSU1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 22838-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

C7orf30, Mitochondrial assembly of ribosomal large subunit protein 1

---

Product Information

22838-1-PBS targets MALSU1 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18286

  Product name: Recombinant human C7orf30 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-234 aa of BC012331

  Sequence: MGPGGRVARLLAPLMWRRAVSSVAGSAVGAEPGLRLLAVQRLPVGAAFCRACQTPNFVRGLHSEPGLEERAEGTVNEGRPESDAADHTGPKFDIDMMVSLLRQENARDICVIQVPPEMRYTDYFVIVSGTSTRHLHAMAFYVVKMYKHLKCKRDPHVKIEGKDTDDWLCVDFGSMVIHLMLPETREIYELEKLWTLRSYDDQLAQIAPETVPEDFILGIEDDTSSVTPVELKCE

• Full Name: Mitochondrial assembly of ribosomal large subunit protein 1
• Calculated Molecular Weight: 234 aa, 26 kDa
• Observed Molecular Weight: 26-28 kDa
• GenBank Accession Number: BC012331
• Gene Symbol: MALSU1
• Gene ID (NCBI): 115416
• RRID: AB_11182483
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96EH3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

C7orf30, also known as MALSU1, is a member of the iojap protein family. It was predicted to enable ribosomal large subunit binding activity. It was Involved in negative regulation of mitochondrial translation and ribosomal large subunit biogenesis.