C7orf49 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• C7orf49 Polyclonal antibody, PBS Only (15076-1-PBS)

• 

  IHC staining of human skin using 15076-1-AP (same clone as 15076-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 15076-1-AP (C7orf49 Antibody) at dilution of 1:25 (under 10x lens). This data was developed using the same antibody clone with 15076-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin using 15076-1-AP (same clone as 15076-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 15076-1-AP (C7orf49 Antibody) at dilution of 1:25 (under 40x lens). This data was developed using the same antibody clone with 15076-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 15076-1-AP (same clone as 15076-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 15076-1-AP (C7orf49 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15076-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin using 15076-1-AP (same clone as 15076-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 15076-1-AP (C7orf49 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 15076-1-PBS in a different storage buffer formulation.

C7orf49 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 15076-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

Cell cycle regulator of NHEJ, Cell cycle regulator of non-homologous end joining, CYREN, MRI

---

Product Information

15076-1-PBS targets C7orf49 in IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7148

  Product name: Recombinant human C7orf49 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-129 aa of BC000168

  Sequence: MKAPKRMRMAAVPVAAARLPATRTVYCMNEAEIVDVALGILIESRKQEKACEQPALAGADNPEHSPPCSVSPHTSSGSSSEEEDSGKQALAPGLSPSQRPGGSSSACSRSPEEEEEEDVLKYVREIFFS

• Full Name: chromosome 7 open reading frame 49
• Calculated Molecular Weight: 17 kDa
• GenBank Accession Number: BC000168
• Gene Symbol: C7orf49
• Gene ID (NCBI): 78996
• RRID: AB_2878107
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BWK5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

C7orf49, also named as MRI, may act as a regulator of proteasome.