C8B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• C8B Polyclonal antibody, PBS Only (25184-1-PBS)

• 

  WB analysis of human plasma using 25184-1-AP (same clone as 25184-1-PBS)

  human plasma was subjected to SDS PAGE followed by western blot with 25184-1-AP (C8B antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25184-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 25184-1-AP (same clone as 25184-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 25184-1-AP (C8B antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25184-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 25184-1-AP (same clone as 25184-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 25184-1-AP (C8B antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25184-1-PBS in a different storage buffer formulation.

C8B Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 25184-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

CO8B, Complement component 8 subunit beta, complement component 8, beta polypeptide, Complement component C8 beta chain

---

Product Information

25184-1-PBS targets C8B in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18388

  Product name: Recombinant human C8B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 242-591 aa of BC130575

  Sequence: RNVTEKMASKSGFSFGFKIPGIFELGISSQSDRGKHYIRRTKRFSHTKSVFLHARSDLEVAHYKLKPRSLMLHYEFLQRVKRLPLEYSYGEYRDLFRDFGTHYITEAVLGGIYEYTLVMNKEAMERGDYTLNNVHACAKNDFKIGGAIEEVYVSLGVSVGKCRGILNEIKDRNKRDTMVEDLVVLVRGGASEHITTLAYQELPTADLMQEWGDAVQYNPAIIKVKVEPLYELVTATDFAYSSTVRQNMKQALEEFQKEVSSCHCAPCQGNGVPVLKGSRCDCICPVGSQGLACEVSYRKNTPIDGKWNCWSNWSSCSGRRKTRQRQCNNPPPQNGGSPCSGPASETLDCS

• Full Name: complement component 8, beta polypeptide
• Calculated Molecular Weight: 591 aa, 67 kDa
• Observed Molecular Weight: 64 kDa
• GenBank Accession Number: BC130575
• Gene Symbol: C8B
• Gene ID (NCBI): 732
• RRID: AB_3085774
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P07358
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The beta chain of complement component 8 (C8B) is one of three different subunits (alpha, beta, and gamma) of the complement component 8 (C8), which is a component of the MAC (membrane attack complex). The deficiency of C8B leads to the type II of C8 deficiency, leading to the malfunction of MAC.