C9orf80 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• C9orf80 Polyclonal antibody, PBS Only (26127-1-PBS)

• 

  IHC staining of mouse brain using 26127-1-AP (same clone as 26127-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 26127-1-AP (C9orf80 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26127-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 26127-1-AP (same clone as 26127-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 26127-1-AP (C9orf80 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26127-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 26127-1-AP (same clone as 26127-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using C9orf80 antibody (26127-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 26127-1-PBS in a different storage buffer formulation.

C9orf80 Polyclonal Antibody for IHC, IF/ICC, Indirect ELISA

Cat No. 26127-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, Indirect ELISA

Synonyms

SOSS C, Sensor of ssDNA subunit C, INIP, hSSBIP1, HSPC291

---

Product Information

26127-1-PBS targets C9orf80 in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23582

  Product name: Recombinant human C9orf80 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-104 aa of BC014881

  Sequence: MAANSSGQGFQNKNRVAILAELDKEKRKLLMQNQSSTNHPGASIALSRPSLNKDFRDHAEQQHIAAQQKAALQHAHAHSSGYFITQDSAFGNLILPVLPRLDPE

• Full Name: chromosome 9 open reading frame 80
• GenBank Accession Number: BC014881
• Gene Symbol: C9orf80
• Gene ID (NCBI): 58493
• RRID: AB_3669523
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NRY2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

C9orf80 (INIP) is also a nuclear protein related to protein synthesis and transportation. C9orf80 is a member of the core hSSB1 complex, which plays an important role in DNA damage response and genome stability maintenance(PMID: 23986477).