CA11 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CA11 Polyclonal antibody, PBS Only (15435-1-PBS)

• 

  WB analysis of human kidney using 15435-1-AP (same clone as 15435-1-PBS)

  human kidney tissue were subjected to SDS PAGE followed by western blot with 15435-1-AP (CA11 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15435-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human kidney using 15435-1-AP (same clone as 15435-1-PBS)

  human kidney tissue were subjected to SDS PAGE followed by western blot with 15435-1-AP (CA11 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15435-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 15435-1-AP (same clone as 15435-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 15435-1-AP (CA11 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 15435-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 15435-1-AP (same clone as 15435-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 15435-1-AP (CA11 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 15435-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 15435-1-AP (same clone as 15435-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta using 15435-1-AP (CA11 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 15435-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 15435-1-AP (same clone as 15435-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta using 15435-1-AP (CA11 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 15435-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 15435-1-AP (same clone as 15435-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 15435-1-AP (CA11 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 15435-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 15435-1-AP (same clone as 15435-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 15435-1-AP (CA11 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 15435-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human spleen using 15435-1-AP (same clone as 15435-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen using 15435-1-AP (CA11 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 15435-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human spleen using 15435-1-AP (same clone as 15435-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen using 15435-1-AP (CA11 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 15435-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 15435-1-AP (same clone as 15435-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung using 15435-1-AP (CA11 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 15435-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 15435-1-AP (same clone as 15435-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung using 15435-1-AP (CA11 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 15435-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary using 15435-1-AP (same clone as 15435-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary using 15435-1-AP (CA11 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 15435-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary using 15435-1-AP (same clone as 15435-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary using 15435-1-AP (CA11 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 15435-1-PBS in a different storage buffer formulation.

CA11 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 15435-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

CA RP II, CA RP XI, CA XI, carbonic anhydrase XI, Carbonic anhydrase-related protein 11

---

Product Information

15435-1-PBS targets CA11 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7712

  Product name: Recombinant human CA11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 12-328 aa of BC002662

  Sequence: ALVLWAALGAAAHIGPAPDPEDWWSYKDNLQGNFVPGPPFWGLVNAAWSLCAVGKRQSPVDVELKRVLYDPFLPPLRLSTGGEKLRGTLYNTGRHVSFLPAPRPVVNVSGGPLLYSHRLSELRLLFGARDGAGSEHQINHQGFSAEVQLIHFNQELYGNFSAASRGPNGLAILSLFVNVASTSNPFLSRLLNRDTITRISYKNDAYFLQDLSLELLFPESFGFITYQGSLSTPPCSETVTWILIDRALNITSLQMHSLRLLSQNPPSQIFQSLSGNSRPLQPLAHRALRGNRDPRHPERRCRGPNYRLHVDGVPHGR

• Full Name: carbonic anhydrase XI
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 36, 45 kDa
• GenBank Accession Number: BC002662
• Gene Symbol: CA11
• Gene ID (NCBI): 770
• RRID: AB_2065700
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75493
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CA11(Carbonic anhydrase-related protein 11) is also named CARP2, and CARP XI and belongs to the alpha-carbonic anhydrase family. CARP XI is observed in the cerebellum, cerebrum, liver, stomach, small intestine, colon, kidney, and testis by immunohistochemical, and in the cerebellum, the most prominent signal is located in the Purkinje cells(PMID:20356370). CARP XI contains a hydrophobic N-terminal region for a possible signal sequence and asparagine glycosylation site and it plays a general role in the human central nervous system(PMID: 10350627).