CA13 Recombinant monoclonal antibody, PBS Only

CA13 Uni-rAb® Recombinant Antibody for WB, Indirect ELISA
Cat No. 86178-1-PBS
Clone No.250787A12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

CA XIII, Carbonate dehydratase XIII, Carbonic anhydrase 13, Carbonic anhydrase XIII, CAXIII

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86178-1-PBS targets CA13 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag10086

Product name: Recombinant human CA13 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-262 aa of BC052602

Sequence: MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH

Predict reactive species
Full Name carbonic anhydrase XIII
Calculated Molecular Weight 262 aa, 29 kDa
Observed Molecular Weight30 kDa
GenBank Accession NumberBC052602
Gene Symbol CA13
Gene ID (NCBI) 377677
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8N1Q1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Carbonic anhydrases (CAs) are zinc-containing metalloenzymes that catalyze the reversible hydration of carbon dioxide. The mammalian α-CA gene family has been reported to include at least eleven enzymatically active isoforms with different structural and catalytic properties. Four of the active CA isozymes are cytosolic (CA I, II, III, and VII), four are membrane-associated(CA IV, IX, XII, and XIV), two are mitochondrial (CA VA and VB), and one is a secretory form (CA VI). CA13 is a cytosolic protein that may play a role in embryogenesis and perturbation of its function by genetic modification could potentially lead to developmental abnormalities(PMID:14600151).

Loading...
||
New chat Able
正在加载,请稍候...