CA13 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of HepG2 using 86178-1-RR (same clone as 86178-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 86178-1-RR (CA13 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86178-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 86178-1-RR (same clone as 86178-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86178-1-RR (CA13 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86178-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 86178-1-RR (same clone as 86178-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 86178-1-RR (CA13 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86178-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86178-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86178-1-RR against Human CA13 were performed. The affinity constant is 4.50 nM.

CA13 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86178-1-PBS

Clone No.250787A12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

CA XIII, Carbonate dehydratase XIII, Carbonic anhydrase 13, Carbonic anhydrase XIII, CAXIII

---

Product Information

86178-1-PBS targets CA13 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag10086

  Product name: Recombinant human CA13 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-262 aa of BC052602

  Sequence: MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH

• Full Name: carbonic anhydrase XIII
• Calculated Molecular Weight: 262 aa, 29 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC052602
• Gene Symbol: CA13
• Gene ID (NCBI): 377677
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8N1Q1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Carbonic anhydrases (CAs) are zinc-containing metalloenzymes that catalyze the reversible hydration of carbon dioxide. The mammalian α-CA gene family has been reported to include at least eleven enzymatically active isoforms with different structural and catalytic properties. Four of the active CA isozymes are cytosolic (CA I, II, III, and VII), four are membrane-associated(CA IV, IX, XII, and XIV), two are mitochondrial (CA VA and VB), and one is a secretory form (CA VI). CA13 is a cytosolic protein that may play a role in embryogenesis and perturbation of its function by genetic modification could potentially lead to developmental abnormalities(PMID:14600151).