CA13 Recombinant monoclonal antibody

CA13 Uni-rAb® Recombinant Antibody for WB, ELISA
Cat No. 86178-1-RR
Clone No.250787A12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

CA XIII, Carbonate dehydratase XIII, Carbonic anhydrase 13, Carbonic anhydrase XIII, CAXIII

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, mouse thymus tissue, NIH/3T3 cells, rat small intestine tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

86178-1-RR targets CA13 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag10086

Product name: Recombinant human CA13 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-262 aa of BC052602

Sequence: MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH

Predict reactive species
Full Name carbonic anhydrase XIII
Calculated Molecular Weight 262 aa, 29 kDa
Observed Molecular Weight30 kDa
GenBank Accession NumberBC052602
Gene Symbol CA13
Gene ID (NCBI) 377677
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8N1Q1
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Carbonic anhydrases (CAs) are zinc-containing metalloenzymes that catalyze the reversible hydration of carbon dioxide. The mammalian α-CA gene family has been reported to include at least eleven enzymatically active isoforms with different structural and catalytic properties. Four of the active CA isozymes are cytosolic (CA I, II, III, and VII), four are membrane-associated(CA IV, IX, XII, and XIV), two are mitochondrial (CA VA and VB), and one is a secretory form (CA VI). CA13 is a cytosolic protein that may play a role in embryogenesis and perturbation of its function by genetic modification could potentially lead to developmental abnormalities(PMID:14600151).

Protocols

Product Specific Protocols
WB protocol for CA13 antibody 86178-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...