MUC1/CA15-3 C-terminal Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83311-4-RR (same clone as 83311-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83311-4-RR (MUC1/CA15-3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83311-4-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 83311-4-RR (same clone as 83311-4-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 83311-4-RR (MUC1/CA15-3 C-terminal antibody) at dilution of 1:800 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer(pH9). This data was developed using the same antibody clone with 83311-4-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 83311-4-RR (same clone as 83311-4-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 83311-4-RR (MUC1/CA15-3 C-terminal antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83311-4-PBS in a different storage buffer formulation.

• 

  IHC staining of human rectal cancer using 83311-4-RR (same clone as 83311-4-PBS)

  Immunohistochemical analysis of paraffin-embedded human rectal cancer tissue slide using 83311-4-RR (MUC1/CA15-3 C-terminal antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83311-4-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 83311-4-RR (same clone as 83311-4-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 83311-4-RR (MUC1/CA15-3 C-terminal antibody) at dilution of 1:800 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83311-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83311-4-RR

  Biolayer interferometry (BLl) kinetic assays of 83311-4-RR against Human CA15-3/MUC1 were performed. The affinity constant is 63.7 pM.

MUC1/CA15-3 C-terminal Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 83311-4-PBS

Clone No.240190G10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

CA15-3,MUC1, CA15-3, CA153, MUC1, CA15 3

---

Product Information

83311-4-PBS targets MUC1/CA15-3 C-terminal in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag20366

  Product name: Recombinant human CA15-3,MUC1 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1055-1255 aa of BC120975

  Sequence: NSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPGWGIALLVLVCVLVALAIVYLIALAVCQCRRKNYGQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSLSYTNPAVAATSANL

• Full Name: mucin 1, cell surface associated
• Calculated Molecular Weight: 1264 aa, 123 kDa
• Observed Molecular Weight: 23-30 kDa
• GenBank Accession Number: BC120975
• Gene Symbol: MUC1/CA15-3
• Gene ID (NCBI): 4582
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P15941
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MUC1 is a type I transmembrane glycoprotein expressed by various epithelial cells of the female reproductive tract, lung, breast, kidney, stomach, and pancreas. MUC1 is transcribed as a large precursor gene product, and upon translation, is cleaved in the endoplasmic reticulum, yielding two subunits: the large extracellular N-terminal subunit (MUC1-N, about 120-200 kDa) and the small cytoplasmic C-terminal subunit (MUC1-C, about 23-30 kDa). Among the known mucins, MUC1 is best studied and plays crucial roles in regulating many cellular properties, including cell proliferation, apoptosis, adhesion, and invasion. MUC1 is overexpressed in a wide range of human epithelial malignancies. This antibody was raised against the C-terminal region of human MUC1, thus it recognizes the 23-30 kDa cytoplasmic MUC1.