MUC1/CA15-3 C-terminal Recombinant monoclonal antibody

MUC1/CA15-3 C-terminal Uni-rAb® Recombinant Antibody for WB, IHC, ELISA

Cat No. 83311-4-RR
Clone No.240190G10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

CA15-3, CA153, MUC1, CA15 3, CA 15-3

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inBxPC-3 cells, mouse lung tissue
Positive IHC detected inhuman stomach cancer tissue, human ovary cancer tissue, human rectal cancer tissue, human tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83311-4-RR targets MUC1/CA15-3 C-terminal in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag20366

Product name: Recombinant human CA15-3,MUC1 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 1055-1255 aa of BC120975

Sequence: NSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPGWGIALLVLVCVLVALAIVYLIALAVCQCRRKNYGQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSLSYTNPAVAATSANL

Predict reactive species
Full Name mucin 1, cell surface associated
Calculated Molecular Weight 1264 aa, 123 kDa
Observed Molecular Weight 23-30 kDa
GenBank Accession NumberBC120975
Gene Symbol MUC1/CA15-3
Gene ID (NCBI) 4582
RRIDAB_3670978
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP15941
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MUC1 is a type I transmembrane glycoprotein expressed by various epithelial cells of the female reproductive tract, lung, breast, kidney, stomach, and pancreas. MUC1 is transcribed as a large precursor gene product, and upon translation, is cleaved in the endoplasmic reticulum, yielding two subunits: the large extracellular N-terminal subunit (MUC1-N, about 120-200 kDa) and the small cytoplasmic C-terminal subunit (MUC1-C, about 23-30 kDa). Among the known mucins, MUC1 is best studied and plays crucial roles in regulating many cellular properties, including cell proliferation, apoptosis, adhesion, and invasion. MUC1 is overexpressed in a wide range of human epithelial malignancies. This antibody was raised against the C-terminal region of human MUC1, thus it recognizes the 23-30 kDa cytoplasmic MUC1.

Protocols

Product Specific Protocols
WB protocol for MUC1/CA15-3 C-terminal antibody 83311-4-RRDownload protocol
IHC protocol for MUC1/CA15-3 C-terminal antibody 83311-4-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...