Carbonic Anhydrase 4/CA4 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Carbonic Anhydrase 4/CA4 Recombinant monoclonal antibody (85706-1-RR)

• 

  WB analysis using 85706-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 85706-1-RR (Carbonic Anhydrase 4/CA4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse lung using 85706-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 85706-1-RR (Carbonic Anhydrase 4/CA4 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  Affinity and Kinetic Characterization of 85706-1-RR

  Biolayer interferometry (BLl) kinetic assays of 85706-1-RR against Human CA4 were performed. The affinity constant is 9.62 nM.

Carbonic Anhydrase 4/CA4 Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 85706-1-RR

Clone No.242975A3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

CA4, CA IV, CAIV, CA-IV, Car4

---

Tested Applications

• Positive WB detected in: mouse lung tissue, rat lung tissue
• Positive IHC detected in: mouse lung tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

85706-1-RR targets Carbonic Anhydrase 4/CA4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag4960

  Product name: Recombinant human CA4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 17-284 aa of BC057792

  Sequence: ASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKS

• Full Name: carbonic anhydrase IV
• Calculated Molecular Weight: 35 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC057792
• Gene Symbol: CA4
• Gene ID (NCBI): 762
• RRID: AB_3744307
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P22748
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CA4(Carbonic anhydrase 4) is a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary, chorionic (and certain other) capillaries and of proximal renal tubules. It plays a critical role by maintaining the pH in the outer retina, which is important for the normal function of photoreceptors. This protein belongs to the alpha-carbonic anhydrase family.