Carbonic Anhydrase 4/CA4 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Carbonic Anhydrase 4/CA4 Recombinant monoclonal antibody, PBS Only (85706-1-PBS)

• 

  WB analysis using 85706-1-RR (same clone as 85706-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85706-1-RR (Carbonic Anhydrase 4/CA4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85706-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse lung using 85706-1-RR (same clone as 85706-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 85706-1-RR (Carbonic Anhydrase 4/CA4 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85706-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85706-1-RR

  Biolayer interferometry (BLl) kinetic assays of 85706-1-RR against Human CA4 were performed. The affinity constant is 9.62 nM.

Carbonic Anhydrase 4/CA4 Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 85706-1-PBS

Clone No.242975A3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

CA4, CA IV, CAIV, CA-IV, Car4

---

Product Information

85706-1-PBS targets Carbonic Anhydrase 4/CA4 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag4960

  Product name: Recombinant human CA4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 17-284 aa of BC057792

  Sequence: ASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSDLPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGFQPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFREPIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKS

• Full Name: carbonic anhydrase IV
• Calculated Molecular Weight: 35 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC057792
• Gene Symbol: CA4
• Gene ID (NCBI): 762
• RRID: AB_3744307
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P22748
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CA4(Carbonic anhydrase 4) is a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary, chorionic (and certain other) capillaries and of proximal renal tubules. It plays a critical role by maintaining the pH in the outer retina, which is important for the normal function of photoreceptors. This protein belongs to the alpha-carbonic anhydrase family.