CABYR Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• CABYR Recombinant monoclonal antibody, PBS Only (87074-1-PBS)

• 

  WB analysis using 87074-1-RR (same clone as 87074-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87074-1-RR (CABYR antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87074-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 87074-1-RR (same clone as 87074-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 87074-1-RR (CABYR antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 87074-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 87074-1-RR (same clone as 87074-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 87074-1-RR (CABYR antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 87074-1-PBS in a different storage buffer formulation.

CABYR Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 87074-1-PBS

Clone No.252259B4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

Calcium binding protein 86, Calcium-binding protein 86, Calcium-binding tyrosine phosphorylation-regulated protein, Cancer/testis antigen 88, CBP86

---

Product Information

87074-1-PBS targets CABYR in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag3012

  Product name: Recombinant human CABYR protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 3-379 aa of BC011996

  Sequence: SSKPRLVVPYGLKTLLEGISRAVLKTNPSNINQFAAAYFQELTMYRGNTTMDIKDLVKQFHQIKVEKWSEGTTPQKKLECLKEPGKTSVESKVPTQMEKSTDTDEDNVTRTEYSDKTTQFPSVYAVPGTEQTEAVGGLSSKPATPKTTTPPSSPPPTAVSPEFAYVPADPAQLAAQMLAMATSERGQPPPCSNMWTLYCLTDKNQQGHPSPPPAPGPFPQATLYLPNPKDPQFQQHPPKVTFPTYVMGDTKKTSAPPFILVGSNVQEAQGWKPLPGHAVVSQSDVLRYVAMQVPIAVPADEKYQKHTLSPQNANPPSGQDVPRPKSPVFLSVAFPVEDVAKKSSGSGDKCAPFGSYGIAGEVTVTTAHKRRKAETEN

• Full Name: calcium binding tyrosine-(Y)-phosphorylation regulated
• Calculated Molecular Weight: 53 kDa
• Observed Molecular Weight: 53 kDa
• GenBank Accession Number: BC011996
• Gene Symbol: CABYR
• Gene ID (NCBI): 26256
• RRID: AB_3745319
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O75952
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.