CABYR Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• CABYR Recombinant monoclonal antibody (87074-1-RR)

• 

  WB analysis using 87074-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87074-1-RR (CABYR antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse testis using 87074-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 87074-1-RR (CABYR antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 87074-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 87074-1-RR (CABYR antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

CABYR Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 87074-1-RR

Clone No.252259B4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

Calcium binding protein 86, Calcium-binding protein 86, Calcium-binding tyrosine phosphorylation-regulated protein, Cancer/testis antigen 88, CBP86

---

Tested Applications

• Positive WB detected in: mouse testis tissue, rat testis tissue, human testis tissue
• Positive IHC detected in: mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87074-1-RR targets CABYR in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag3012

  Product name: Recombinant human CABYR protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 3-379 aa of BC011996

  Sequence: SSKPRLVVPYGLKTLLEGISRAVLKTNPSNINQFAAAYFQELTMYRGNTTMDIKDLVKQFHQIKVEKWSEGTTPQKKLECLKEPGKTSVESKVPTQMEKSTDTDEDNVTRTEYSDKTTQFPSVYAVPGTEQTEAVGGLSSKPATPKTTTPPSSPPPTAVSPEFAYVPADPAQLAAQMLAMATSERGQPPPCSNMWTLYCLTDKNQQGHPSPPPAPGPFPQATLYLPNPKDPQFQQHPPKVTFPTYVMGDTKKTSAPPFILVGSNVQEAQGWKPLPGHAVVSQSDVLRYVAMQVPIAVPADEKYQKHTLSPQNANPPSGQDVPRPKSPVFLSVAFPVEDVAKKSSGSGDKCAPFGSYGIAGEVTVTTAHKRRKAETEN

• Full Name: calcium binding tyrosine-(Y)-phosphorylation regulated
• Calculated Molecular Weight: 53 kDa
• Observed Molecular Weight: 53 kDa
• GenBank Accession Number: BC011996
• Gene Symbol: CABYR
• Gene ID (NCBI): 26256
• RRID: AB_3745319
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O75952
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.