CACNA1A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CACNA1A Polyclonal antibody, PBS Only (27227-1-PBS)

• 

  IHC staining of human brain using 27227-1-AP (same clone as 27227-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 27227-1-AP (CACNA1A Antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27227-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 27227-1-AP (same clone as 27227-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 27227-1-AP (CACNA1A Antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27227-1-PBS in a different storage buffer formulation.

CACNA1A Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 27227-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

27227-1-PBS targets CACNA1A in IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25943

  Product name: Recombinant human CACNA1A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 821-920 aa of NM_000068

  Sequence: MDRPLVVDPQENRNNNTNKSRAAEPTVDQRLGQQRAEDFLRKQARYHDRARDPSGSAGLDARRPWAGSQEAELSREGPYGRESDHHAREGSLEQPGFWEGE

• Full Name: calcium channel, voltage-dependent, P/Q type, alpha 1A subunit
• Calculated Molecular Weight: 282 kDa
• GenBank Accession Number: NM_000068
• Gene Symbol: CACNA1A
• Gene ID (NCBI): 773
• RRID: AB_2880810
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00555
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.