CACNB3 Recombinant monoclonal antibody, PBS Only (Capture)

CACNB3 Uni-rAb® Recombinant Antibody for WB, IHC, Cytometric bead array, Indirect ELISA
Cat No. 84762-3-PBS
Clone No.242088G1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

242088G1, CAB3, CACNB 3, CACNLB3

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84762-3-PBS targets CACNB3 as part of a matched antibody pair:

MP01545-1: 84762-3-PBS capture and 84762-2-PBS detection (validated in Cytometric bead array)

MP01545-2: 84762-3-PBS capture and 84762-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag35651

Product name: Recombinant human CACNB3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 351-484 aa of NM_000725.3

Sequence: EYLEVYWRATHHPAPGPGLLGPPSAIPGLQNQQLLGERGEEHSPLERDSLMPSDEASESSRQAWTGSSQRSSRHLEEDYADAYQDLYQPHRQHTSGLPSANGHDPQDRLLAQDSEHNHSDRNWQRNRPWPKDSY

Predict reactive species
Full Name calcium channel, voltage-dependent, beta 3 subunit
Calculated Molecular Weight55kDa,484aa
Observed Molecular Weight58 kDa
GenBank Accession NumberNM_000725.3
Gene Symbol CACNB3
Gene ID (NCBI) 784
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP54284
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CACNB3, also known as CACNLB3, is a voltage-gated Ca2+ channel subunit. It has 5 isoforms and may play a role in the regulation of transcription factors and calcium transport.

Loading...
||
New chat Able
正在加载,请稍候...