CACNB3 Recombinant monoclonal antibody

• 

  WB analysis using 84762-3-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 84762-3-RR (CACNB3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 84762-3-RR

  Mouse brain tissue were subjected to SDS PAGE followed by western blot with 84762-3-RR (CACNB3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 84762-3-RR

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 84762-3-RR (CACNB3 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  Affinity and Kinetic Characterization of 84762-3-RR

  Biolayer interferometry (BLl) kinetic assays of 84762-3-RR against Human CACNB3 were performed. The affinity constant is 0.241 nM.

CACNB3 Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 84762-3-RR

Clone No.242088G1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

242088G1, CAB3, CACNB 3, CACNLB3

---

Tested Applications

• Positive WB detected in: MCF-7 cells, mouse brain tissue, HeLa cells, SH-SY5Y cells, SKOV-3 cells, SW480 cells
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84762-3-RR targets CACNB3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag35651

  Product name: Recombinant human CACNB3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 351-484 aa of NM_000725.3

  Sequence: EYLEVYWRATHHPAPGPGLLGPPSAIPGLQNQQLLGERGEEHSPLERDSLMPSDEASESSRQAWTGSSQRSSRHLEEDYADAYQDLYQPHRQHTSGLPSANGHDPQDRLLAQDSEHNHSDRNWQRNRPWPKDSY

• Full Name: calcium channel, voltage-dependent, beta 3 subunit
• Calculated Molecular Weight: 55kDa，484aa
• Observed Molecular Weight: 58 kDa
• GenBank Accession Number: NM_000725.3
• Gene Symbol: CACNB3
• Gene ID (NCBI): 784
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P54284
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CACNB3, also known as CACNLB3, is a voltage-gated Ca2+ channel subunit. It has 5 isoforms and may play a role in the regulation of transcription factors and calcium transport.