CACNG3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CACNG3 Polyclonal antibody, PBS Only (13729-1-PBS)

• 

  WB analysis of HEK-293 using 13729-1-AP (same clone as 13729-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 13729-1-AP (CACNG3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13729-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse kidney using 13729-1-AP (same clone as 13729-1-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 13729-1-AP (CACNG3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13729-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 13729-1-AP (same clone as 13729-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 13729-1-AP (CACNG3 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13729-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 13729-1-AP (same clone as 13729-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 13729-1-AP (CACNG3 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13729-1-PBS in a different storage buffer formulation.

CACNG3 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 13729-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

Voltage-dependent calcium channel gamma-3 subunit, Transmembrane AMPAR regulatory protein gamma-3, TARP gamma-3, Neuronal voltage-gated calcium channel gamma-3 subunit

---

Product Information

13729-1-PBS targets CACNG3 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4730

  Product name: Recombinant human CACNG3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 202-315 aa of BC040005

  Sequence: EKHQQLRAKSHSEFLKKSTFARLPPYRYRFRRRSSSRSTEPRSRDLSPISKGFHTIPSTDISMFTLSRDPSKITMGTLLNSDRDHAFLQFHNSTPKEFKESLHNNPANRRTTPV

• Full Name: calcium channel, voltage-dependent, gamma subunit 3
• Calculated Molecular Weight: 315 aa, 36 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC040005
• Gene Symbol: CACNG3
• Gene ID (NCBI): 10368
• RRID: AB_2070085
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60359
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Voltage-dependent calcium channels couple membrane depolarization in a number of cellular processes. These activities are regulated by distinct channels composed of alpha-1, beta, alpha-2/delta, and gamma subunits. CACNG3, one of the eight gamma subunits in human, is a type I transmembrane AMPA receptor regulatory protein (TARP). TARPs regulate both trafficking and channel gating of the AMPA receptors.