CACNG5 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CACNG5 Polyclonal antibody, PBS Only (18498-1-PBS)

• 

  WB analysis of SH-SY5Y using 18498-1-AP (same clone as 18498-1-PBS)

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 18498-1-AP (CACNG5 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18498-1-PBS in a different storage buffer formulation.

• 

  WB analysis of SH-SY5Y using 18498-1-AP (same clone as 18498-1-PBS)

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 18498-1-AP (CACNG5 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18498-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 18498-1-AP (same clone as 18498-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 18498-1-AP (CACNG5 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18498-1-PBS in a different storage buffer formulation.

CACNG5 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 18498-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

18498-1-PBS targets CACNG5 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13339

  Product name: Recombinant human CACNG5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-275 aa of BC101607

  Sequence: MSACGRKALTLLSSVFAVCGLGLLGIAVSTDYWLYLEEGVIVPQNQSTEIKMSLHSGLWRVCFLAGEERGRCFTIEYVMPMNTQLTSESTVNVLKMIRSATPFPLVSLFFMFIGFILNNIGHIRPHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEMLNRTKDAETYFNYKYGWSFAFAAISFLLTESAGVMSVYLFMKRYTAEDMYRPHPGFYRPRLSNCSDYSGQFLHPDAWVRGRSPSDISSEASLQMNSNYPALLKCPDYDQMSSSPC

• Full Name: calcium channel, voltage-dependent, gamma subunit 5
• Calculated Molecular Weight: 275 aa, 31 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC101607
• Gene Symbol: CACNG5
• Gene ID (NCBI): 27091
• RRID: AB_10667007
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UF02
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.