Filter: AllIHC

IHC staining of mouse brain using 17862-1-AP (same clone as 17862-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 17862-1-AP (CACNG7 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17862-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 17862-1-AP (same clone as 17862-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 17862-1-AP (CACNG7 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17862-1-PBS in a different storage buffer formulation.

CACNG7 Polyclonal antibody, PBS Only

Name: CACNG7 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 17862-1-PBS

CACNG7 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 17862-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

17862-1-PBS targets CACNG7 in IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag12334 Product name: Recombinant human CACNG7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 154-275 aa of BC093869 Sequence: SSINDEVMNRPSSSEQYFHYRYGWSFAFAASSFLLKEGAGVMSVYLFTKRYAEEEMYRPHPAFYRPRLSDCSDYSGQFLQPEAWRRGRSPSDISSDVSIQMTQNYPPAIKYPDHLHISTSPC Predict reactive species
Full Name	calcium channel, voltage-dependent, gamma subunit 7
Calculated Molecular Weight	275 aa, 31 kDa
GenBank Accession Number	BC093869
Gene Symbol	CACNG7
Gene ID (NCBI)	59284
RRID	AB_2878456
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P62955
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Able™