Product Information
17862-1-PBS targets CACNG7 in IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag12334 Product name: Recombinant human CACNG7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 154-275 aa of BC093869 Sequence: SSINDEVMNRPSSSEQYFHYRYGWSFAFAASSFLLKEGAGVMSVYLFTKRYAEEEMYRPHPAFYRPRLSDCSDYSGQFLQPEAWRRGRSPSDISSDVSIQMTQNYPPAIKYPDHLHISTSPC Predict reactive species |
| Full Name | calcium channel, voltage-dependent, gamma subunit 7 |
| Calculated Molecular Weight | 275 aa, 31 kDa |
| GenBank Accession Number | BC093869 |
| Gene Symbol | CACNG7 |
| Gene ID (NCBI) | 59284 |
| RRID | AB_2878456 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P62955 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |



