CALCA/Calcitonin Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CALCA/Calcitonin Polyclonal antibody, PBS Only (22244-1-PBS)

• 

  WB analysis using 22244-1-AP (same clone as 22244-1-PBS)

  TT cells were subjected to SDS PAGE followed by western blot with 22244-1-AP (CGRP antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22244-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Transfected HEK-293 using 22244-1-AP (same clone as 22244-1-PBS)

  Transfected HEK-293 cells were subjected to SDS PAGE followed by western blot with 22244-1-AP (CGRP antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22244-1-PBS in a different storage buffer formulation.

• 

  IP experiment of TT using 22244-1-AP (same clone as 22244-1-PBS)

  IP result of anti-CALCA/CGRP (IP:22244-1-AP, 4ug; Detection:22244-1-AP 1:600) with TT cells lysate 945 ug. This data was developed using the same antibody clone with 22244-1-PBS in a different storage buffer formulation.

CALCA/Calcitonin Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 22244-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, Indirect ELISA

Synonyms

CALCA, Calcitonin, CALC1, Calcitonin gene-related peptide 1, Calcitonin gene-related peptide I

---

Product Information

22244-1-PBS targets CALCA/Calcitonin in WB, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17737

  Product name: Recombinant human CALCA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 65-141 aa of BC093753

  Sequence: ELEQEQEREGSSLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVSMPQNAN

• Full Name: Calcitonin
• Calculated Molecular Weight: 141 aa, 15 kDa
• Observed Molecular Weight: 14 kDa, 5 kDa
• GenBank Accession Number: BC093753
• Gene Symbol: CALCA
• Gene ID (NCBI): 796
• RRID: AB_3669393
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P01258
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Calcitonin is a peptide hormone consisting of 32 amino acids, primarily synthesized by the parafollicular cells (C cells) of the human thyroid gland. It plays a crucial role in regulating calcium levels in the blood by decreasing them. Calcitonin opposes the actions of parathyroid hormone, which increases blood calcium levels. Calcitonin works through a G protein-coupled receptor, known as the calcitonin receptor, which predominantly transmits signals via the cAMP and PLC/IP3 pathways. Its primary physiological effects are on osteoclasts and the tubular epithelium of kidneys.