Product Information
23890-1-PBS targets CALCB in IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20926 Product name: Recombinant human CALCB protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 1-127 aa of BC008428 Sequence: MGFRKFSPFLALSILVLYQAGSLQAAPFRSALESSPDPATLSKEDARLLLAALVQDYVQMKASELKQEQETQGSSSAAQKRACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAFGRRRRDLQA Predict reactive species |
| Full Name | calcitonin-related polypeptide beta |
| Calculated Molecular Weight | 127 aa, 14 kDa |
| GenBank Accession Number | BC008428 |
| Gene Symbol | CALCB |
| Gene ID (NCBI) | 797 |
| RRID | AB_3742094 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen Affinity purified |
| UNIPROT ID | P10092 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |



