NDP52 Monoclonal antibody

• 

  WB analysis using 66401-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66401-1-Ig (NDP52 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 66401-1-Ig

  WB result of NDP52 antibody (66401-1-Ig; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-NDP52 transfected HeLa cells.

• 

  WB analysis of HeLa using 66401-1-Ig

  HeLa, Jurkat cells and human skeletal muscle tissue lysate were subjected to SDS PAGE followed by western blot with 66401-1-Ig (NDP52 Antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary tumor using 66401-1-Ig

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 66401-1-Ig (NDP52 Antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human ovary tumor using 66401-1-Ig

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 66401-1-Ig (NDP52 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IF Staining of Jurkat using 66401-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using NDP52 antibody (66401-1-Ig, Clone: 2F2C2 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

• Featured Product
• KD/KO Validated

NDP52 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66401-1-Ig

Clone No.2F2C2

Publications(4)

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

CALCOCO2, Nuclear dot protein 52, Nuclear domain 10 protein 52, Calcium-binding and coiled-coil domain-containing protein 2, 2F2C2

---

Tested Applications

• Positive WB detected in: A549 cells, HeLa cells, Caco-2 cells, MDA-MB-231 cells, Jurkat cells, MOLT-4 cells, K-562 cells, Karpas-299 cells, human skeletal muscle tissue
• Positive IHC detected in: human ovary tumor tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below
• IF: See 1 publications below

Product Information

66401-1-Ig targets NDP52 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2866

  Product name: Recombinant human CALCOCO2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-283 aa of BC015893

  Sequence: MEETIKDPPTSAVLLDHCHFSQVIFNSVEKFYIPGGDVTCHYTFTQHFIPRRKDWIGIFRVGWKTTREYYTFMWVTLPIDLNNKSAKQQEVQFKAYYLPKDDEYYQFCYVDEDGVVRGASIPFQFRPENEEDILVVTTQGEVEEIEQHNKELCKENQELKDSCISLQKQNSDMQAELQKKQEELETLQSINKKLELKVKEQKDYWETELLQLKEQNQKMSSENEKMGIRVDQLQAQLSTQEKEMEKLVQGDQDKTEQLEQLKKENDHLFLSLTEQRKDQKKLE

• Full Name: calcium binding and coiled-coil domain 2
• Calculated Molecular Weight: 446 aa, 52 kDa
• Observed Molecular Weight: 52 kDa
• GenBank Accession Number: BC015893
• Gene Symbol: NDP52
• Gene ID (NCBI): 10241
• RRID: AB_2881775
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13137
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NDP52, also named as CALCOCO2, is an autophagy receptor. It plays a role in ruffle formation and actin cytoskeleton organization. Mouse/Rat NDP52 has some isoforms with MW 28-40 kDa and 67 kDa. Human NDP52 has some isoforms with MW 43-47 kDa and 52-55 kDa,

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	EMBO Rep; NDP52 interacts with mitochondrial RNA poly(A) polymerase to promote mitophagy.; Authors - Norihiko Furuya
human	WB	Autophagy; Copper-dependent autophagic degradation of GPX4 drives ferroptosis; Authors - Qian Xue
human,mouse	WB	mBio; The nonstructural protein 1 of respiratory syncytial virus hijacks host mitophagy as a novel mitophagy receptor to evade the type I IFN response in HEp-2 cells; Authors - Jing Cheng
mouse	IF	Immunity; The cGAS-STING pathway activates transcription factor TFEB to stimulate lysosome biogenesis and pathogen clearance; Authors - Yinfeng Xu