NDP52 Monoclonal antibody, PBS Only

• 

  WB analysis using 66401-1-Ig (same clone as 66401-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66401-1-Ig (NDP52 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66401-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66401-1-Ig (same clone as 66401-1-PBS)

  WB result of NDP52 antibody (66401-1-Ig; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-NDP52 transfected HeLa cells. This data was developed using the same antibody clone with 66401-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66401-1-Ig (same clone as 66401-1-PBS)

  HeLa, Jurkat cells and human skeletal muscle tissue lysate were subjected to SDS PAGE followed by western blot with 66401-1-Ig (NDP52 Antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66401-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 66401-1-Ig (same clone as 66401-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 66401-1-Ig (NDP52 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 66401-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 66401-1-Ig (same clone as 66401-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 66401-1-Ig (NDP52 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 66401-1-PBS in a different storage buffer formulation.

• 

  IF Staining of Jurkat using 66401-1-Ig (same clone as 66401-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed Jurkat cells using NDP52 antibody (66401-1-Ig, Clone: 2F2C2 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66401-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

NDP52 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 66401-1-PBS

Clone No.2F2C2

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

CALCOCO2, Nuclear dot protein 52, Nuclear domain 10 protein 52, Calcium-binding and coiled-coil domain-containing protein 2, 2F2C2

---

Product Information

66401-1-PBS targets NDP52 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2866

  Product name: Recombinant human CALCOCO2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-283 aa of BC015893

  Sequence: MEETIKDPPTSAVLLDHCHFSQVIFNSVEKFYIPGGDVTCHYTFTQHFIPRRKDWIGIFRVGWKTTREYYTFMWVTLPIDLNNKSAKQQEVQFKAYYLPKDDEYYQFCYVDEDGVVRGASIPFQFRPENEEDILVVTTQGEVEEIEQHNKELCKENQELKDSCISLQKQNSDMQAELQKKQEELETLQSINKKLELKVKEQKDYWETELLQLKEQNQKMSSENEKMGIRVDQLQAQLSTQEKEMEKLVQGDQDKTEQLEQLKKENDHLFLSLTEQRKDQKKLE

• Full Name: calcium binding and coiled-coil domain 2
• Calculated Molecular Weight: 446 aa, 52 kDa
• Observed Molecular Weight: 52 kDa
• GenBank Accession Number: BC015893
• Gene Symbol: NDP52
• Gene ID (NCBI): 10241
• RRID: AB_2881775
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13137
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

NDP52, also named as CALCOCO2, is an autophagy receptor. It plays a role in ruffle formation and actin cytoskeleton organization. Mouse/Rat NDP52 has some isoforms with MW 28-40 kDa and 67 kDa. Human NDP52 has some isoforms with MW 43-47 kDa and 52-55 kDa,