calreticulin Polyclonal antibody

• Home
• Products
• Primary Antibodies
• calreticulin Polyclonal antibody (10292-1-AP)

• Featured Product
• KD/KO Validated

calreticulin Polyclonal Antibody for WB, IHC, FC (Intra), ELISA

Cat No. 10292-1-AP

Publications(168)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, FC (Intra), CoIP, ELISA

Synonyms

CALR, Calregulin, CRT

• 

  WB analysis using 10292-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10292-1-AP (calreticulin antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 10292-1-AP

  WB result of calreticulin antibody (10292-1-AP; 1:300; incubated at room temperature for 1.5 hours) with sh-Control and sh-calreticulin transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 10292-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10292-1-AP (calreticulin antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 10292-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10292-1-AP (calreticulin antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 10292-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10292-1-AP (calreticulin antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 10292-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10292-1-AP (calreticulin antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 10292-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10292-1-AP (calreticulin antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 10292-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 10292-1-AP (calreticulin Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 10292-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 10292-1-AP (calreticulin Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat brain using 10292-1-AP

  rat brain tissue were subjected to SDS PAGE followed by western blot with 10292-1-AP (calreticulin Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of COLO 320 using 10292-1-AP

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 10292-1-AP (calreticulin antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human thyroid using 10292-1-AP

  Immunohistochemical analysis of paraffin-embedded human thyroid tissue slide using 10292-1-AP (calreticulin Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human thyroid using 10292-1-AP

  Immunohistochemical analysis of paraffin-embedded human thyroid tissue slide using 10292-1-AP (calreticulin Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse colon using 10292-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 10292-1-AP (calreticulin antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse colon using 10292-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 10292-1-AP (calreticulin antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse lung using 10292-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 10292-1-AP (calreticulin antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse lung using 10292-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 10292-1-AP (calreticulin antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human thyroid cancer using 10292-1-AP

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 10292-1-AP (calreticulin antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human thyroid cancer using 10292-1-AP

  Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 10292-1-AP (calreticulin antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 10292-1-AP

  Immunohistochemical analysis of paraffin-embedded normal colon slide using 10292-1-AP (calreticulin antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skeletal muscle using 10292-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 10292-1-AP (calreticulin Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skeletal muscle using 10292-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 10292-1-AP (calreticulin Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of Jurkat using 10292-1-AP

  1X10^6 Jurkat cells were intracellularly stained with 0.4 ug Anti-Human calreticulin (10292-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HL-60 cells, A549 cells, COLO 320 cells, HeLa cells, mouse brain tissue, NIH/3T3 cells, rat brain tissue, HepG2 cells, MDA-MB-231 cells, MCF-7 cells, SH-SY5Y cells, L02 cells
• Positive IHC detected in: human thyroid tissue, human normal colon, human skeletal muscle tissue, human thyroid cancer tissue, mouse colon tissue, mouse lung tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive FC (Intra) detected in: Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:10000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10292-1-AP targets calreticulin in WB, IHC, FC (Intra), CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, goat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0325

  Product name: Recombinant human calreticulin protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-200 aa of BC002500

  Sequence: MLLSVPLLLGLLGLAVAEPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDW

• Full Name: calreticulin
• Calculated Molecular Weight: 60 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC002500
• Gene Symbol: Calreticulin
• Gene ID (NCBI): 811
• RRID: AB_2069615
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P27797
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CALR,also named as grp60, ERp60, HACBP, CRP55, CRTC and Calregulin, belongs to the calreticulin family. It is a molecular calcium-binding chaperone promoting folding, oligomeric assembly and quality control in the ER via the calreticulin/calnexin cycle. CALR is a ER marker. It interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. CALR interacts with the DNA-binding domain of NR3C1 and mediates its nuclear export. The MW of CALR migrates aberrantly at 55 kDa by SDS-PAGE. Some study provided that it's a new possibility for CRT-mediated tumor immune prevention and treatment.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,CoIP	Signal Transduct Target Ther; A20 promotes colorectal cancer immune evasion by upregulating STC1 expression to block "eat-me" signal; Authors - Min Luo
mouse		Signal Transduct Target Ther; Spatiotemporally programmed nanomedicine engineering to resolve conflicting immunosignals in triple-negative breast cancer.; Authors - Xiuping Guo
human	WB	Nature; EndoMAP.v1 charts the structural landscape of human early endosome complexes; Authors - Miguel A Gonzalez-Lozano
mouse		J Hematol Oncol; Glutathione reductase deficiency potentiates the immunogenicity of ferroptosis and cuproptosis via amplified reactive oxygen species accumulation and cGAS-STING pathway activation; Authors - Xiaoyi Deng
human	WB	Cell Res; DNA damage triggers tubular endoplasmic reticulum extension to promote apoptosis by facilitating ER-mitochondria signaling.; Authors - Pengli Zheng
		Adv Mater; Reprogramming the Immunosuppressive Microenvironment in Triple-Negative Breast Cancer via FAP-Targeted Nanoprobes for Multimodal Imaging and Photothermal Therapy.; Authors - Ling Zhan