CAMKK2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CAMKK2 Polyclonal antibody, PBS Only (11549-1-PBS)

• 

  WB analysis of Jurkat using 11549-1-AP (same clone as 11549-1-PBS)

  WB result of CAMKK2 antibody (11549-1-AP; 1:800; incubated at room temperature for 1.5 hours) with sh-Control and sh-CAMKK2 transfected Jurkat cells. This data was developed using the same antibody clone with 11549-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 11549-1-AP (same clone as 11549-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11549-1-AP (CAMKK2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11549-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 11549-1-AP (same clone as 11549-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 11549-1-AP (CAMKK2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11549-1-PBS in a different storage buffer formulation.

• 

  WB analysis of fetal human brain using 11549-1-AP (same clone as 11549-1-PBS)

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 11549-1-AP (CAMKK2 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11549-1-PBS in a different storage buffer formulation.

• 

  IP experiment of PC-3 using 11549-1-AP (same clone as 11549-1-PBS)

  IP result of anti-CAMKK2 (IP:11549-1-AP, 4ug; Detection:11549-1-AP 1:500) with PC-3 cells lysate 960 ug. This data was developed using the same antibody clone with 11549-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 11549-1-AP (same clone as 11549-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 11549-1-AP (CAMKK2 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 11549-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 11549-1-AP (same clone as 11549-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 11549-1-AP (CAMKK2 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 11549-1-PBS in a different storage buffer formulation.

• 

  IF Staining of PC-3 using 11549-1-AP (same clone as 11549-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed PC-3 cells using CAMKK2 antibody (11549-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 11549-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CAMKK2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 11549-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

11549-1-PBS targets CAMKK2 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2093

  Product name: Recombinant human CAMKK2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-353 aa of BC026060

  Sequence: MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLARDRPLEADGQEVPLDSSGSQARPHLSGRKLSLQERSQGGLAAGGSLDMNGRCICPSLPYSPVSSPQSSPRLPRRPTVESHHVSITGMQDCVQLNQYTLKDEIGKGSYGVVKLAYNENDNTYYAMKVLSKKKLIRQAGFPRRPPPRGTRPAPGGCIQPRGPIEQVYQEIAILKKLDHPNVVKLVEVLDDPNEDHLYMVFELVNQGPVMEVPTLKPLSEDQARFYFQDLIKGIEYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGTPAF

• Full Name: calcium/calmodulin-dependent protein kinase kinase 2, beta
• Calculated Molecular Weight: 588 aa, 60 kDa
• Observed Molecular Weight: 60-70 kDa
• GenBank Accession Number: BC026060
• Gene Symbol: CAMKK2
• Gene ID (NCBI): 10645
• RRID: AB_2259441
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96RR4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CAMKK2(calcium/calmodulin-dependent protein kinase kinase 2) is also named as CAMKKB, KIAA0787 and belongs to the protein kinase superfamily. It regulates hypothalamic production of the orexigenic hormone NPY and contributes to the regulation of energy balance. CAMKK2 in vivo reduces tumor growth suggests that reactivation of CAMKK2 by development of new drugs may be a new strategy to prolong the period to respond androgen-deprivation therapy(ADT)(PMID:22549914). It can be autophosphorylated(PMID:19369195). It has 7 isoforms produced by alternative splicing.